Detailed information    

insolico Bioinformatically predicted

Overview


Name   CJE1441   Type   Regulator
Locus tag   QMK13_RS06410 Genome accession   NZ_CP125390
Coordinates   1245906..1246559 (+) Length   217 a.a.
NCBI ID   WP_011049930.1    Uniprot ID   A0A3X8NAQ4
Organism   Campylobacter jejuni strain SKBC9     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1227789..1282523 1245906..1246559 within 0


Gene organization within MGE regions


Location: 1227789..1282523
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMK13_RS06270 (QMK13_06270) - 1227789..1228982 (-) 1194 WP_002853860.1 M23 family metallopeptidase -
  QMK13_RS06275 (QMK13_06275) - 1228979..1229785 (-) 807 WP_134249821.1 FtsX-like permease family protein -
  QMK13_RS06280 (QMK13_06280) - 1229772..1230437 (-) 666 WP_002856386.1 ABC transporter ATP-binding protein -
  QMK13_RS06285 (QMK13_06285) trmB 1230507..1231685 (-) 1179 WP_057100755.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  QMK13_RS06290 (QMK13_06290) - 1231685..1232920 (-) 1236 WP_074469125.1 fibronectin type III domain-containing protein -
  QMK13_RS06295 (QMK13_06295) - 1232865..1233833 (-) 969 WP_002937723.1 RluA family pseudouridine synthase -
  QMK13_RS06300 (QMK13_06300) mrdB 1233911..1235011 (+) 1101 WP_002853654.1 FtsW/RodA/SpoVE family cell cycle protein -
  QMK13_RS06310 (QMK13_06310) - 1235350..1236525 (+) 1176 WP_002787311.1 site-specific integrase -
  QMK13_RS06315 (QMK13_06315) - 1236522..1236728 (-) 207 WP_002787309.1 helix-turn-helix domain-containing protein -
  QMK13_RS06320 (QMK13_06320) - 1236730..1237083 (-) 354 WP_002787307.1 hypothetical protein -
  QMK13_RS06325 (QMK13_06325) - 1237101..1237856 (-) 756 WP_002787306.1 site-specific DNA-methyltransferase -
  QMK13_RS06330 (QMK13_06330) - 1237834..1238100 (-) 267 WP_002787304.1 hypothetical protein -
  QMK13_RS06335 (QMK13_06335) - 1238084..1238455 (-) 372 WP_002858334.1 hypothetical protein -
  QMK13_RS06340 (QMK13_06340) - 1238456..1238680 (-) 225 WP_011049924.1 hypothetical protein -
  QMK13_RS06345 (QMK13_06345) - 1238689..1239450 (-) 762 WP_002869676.1 hypothetical protein -
  QMK13_RS06350 (QMK13_06350) - 1239387..1239701 (-) 315 WP_002787295.1 hypothetical protein -
  QMK13_RS06355 (QMK13_06355) - 1239780..1240100 (-) 321 WP_002787293.1 hypothetical protein -
  QMK13_RS06360 (QMK13_06360) - 1240488..1240724 (-) 237 WP_002787289.1 hypothetical protein -
  QMK13_RS06365 (QMK13_06365) - 1240738..1241505 (-) 768 WP_002787287.1 hypothetical protein -
  QMK13_RS06370 (QMK13_06370) - 1241643..1241873 (-) 231 WP_002787283.1 hypothetical protein -
  QMK13_RS06375 (QMK13_06375) - 1241839..1242102 (-) 264 WP_002787281.1 hypothetical protein -
  QMK13_RS06380 (QMK13_06380) - 1242159..1242446 (-) 288 WP_002787279.1 YopX family protein -
  QMK13_RS06385 (QMK13_06385) - 1242499..1243230 (-) 732 WP_011049928.1 phage regulatory protein/antirepressor Ant -
  QMK13_RS06390 (QMK13_06390) - 1243661..1243945 (-) 285 WP_002912332.1 hypothetical protein -
  QMK13_RS06395 (QMK13_06395) - 1243942..1244145 (-) 204 WP_002870299.1 hypothetical protein -
  QMK13_RS06400 (QMK13_06400) - 1244350..1245003 (+) 654 WP_002870336.1 hypothetical protein -
  QMK13_RS06405 (QMK13_06405) - 1245238..1245900 (+) 663 WP_002870274.1 S24/S26 family peptidase -
  QMK13_RS06410 (QMK13_06410) CJE1441 1245906..1246559 (+) 654 WP_011049930.1 DNA/RNA non-specific endonuclease Regulator
  QMK13_RS06415 (QMK13_06415) - 1246576..1246857 (+) 282 WP_002870263.1 PLDc N-terminal domain-containing protein -
  QMK13_RS06420 (QMK13_06420) - 1246871..1247068 (-) 198 WP_002913413.1 hypothetical protein -
  QMK13_RS06425 (QMK13_06425) - 1246986..1247405 (-) 420 WP_002870261.1 hypothetical protein -
  QMK13_RS06430 (QMK13_06430) - 1247634..1248095 (-) 462 WP_002870260.1 DUF5675 family protein -
  QMK13_RS06435 (QMK13_06435) - 1248144..1249427 (-) 1284 WP_002788854.1 hypothetical protein -
  QMK13_RS06440 (QMK13_06440) - 1249424..1249798 (-) 375 WP_283151886.1 DUF1353 domain-containing protein -
  QMK13_RS06445 (QMK13_06445) - 1249791..1250174 (-) 384 WP_002869963.1 hypothetical protein -
  QMK13_RS06450 (QMK13_06450) - 1250171..1250806 (-) 636 WP_002789149.1 DUF4376 domain-containing protein -
  QMK13_RS06455 (QMK13_06455) - 1250819..1251268 (-) 450 WP_283151887.1 hypothetical protein -
  QMK13_RS06460 (QMK13_06460) - 1251270..1252835 (-) 1566 WP_283151888.1 hypothetical protein -
  QMK13_RS06465 (QMK13_06465) - 1252828..1253460 (-) 633 WP_283151889.1 hypothetical protein -
  QMK13_RS06470 (QMK13_06470) - 1253457..1253774 (-) 318 WP_002788295.1 head-tail adaptor protein -
  QMK13_RS06475 (QMK13_06475) - 1253787..1254224 (-) 438 WP_044778997.1 phage gp6-like head-tail connector protein -
  QMK13_RS06480 (QMK13_06480) - 1254221..1254472 (-) 252 WP_002788291.1 hypothetical protein -
  QMK13_RS06485 (QMK13_06485) - 1254483..1255649 (-) 1167 WP_002788288.1 phage major capsid protein -
  QMK13_RS06490 (QMK13_06490) - 1255666..1256223 (-) 558 WP_240682380.1 HK97 family phage prohead protease -
  QMK13_RS06495 (QMK13_06495) - 1256309..1257178 (-) 870 WP_002788286.1 hypothetical protein -
  QMK13_RS06500 (QMK13_06500) - 1257191..1262890 (-) 5700 WP_283151890.1 hypothetical protein -
  QMK13_RS06505 (QMK13_06505) - 1262950..1263288 (+) 339 WP_002788283.1 hypothetical protein -
  QMK13_RS06510 (QMK13_06510) - 1263280..1263495 (-) 216 WP_002788282.1 hypothetical protein -
  QMK13_RS06515 (QMK13_06515) - 1263576..1263932 (-) 357 WP_002788281.1 hypothetical protein -
  QMK13_RS06520 (QMK13_06520) - 1263929..1264909 (-) 981 WP_002788279.1 hypothetical protein -
  QMK13_RS06525 (QMK13_06525) - 1265056..1265280 (+) 225 WP_002869970.1 DUF6290 family protein -
  QMK13_RS06530 (QMK13_06530) - 1265277..1265540 (+) 264 WP_002869971.1 type II toxin-antitoxin system RelE/ParE family toxin -
  QMK13_RS06535 (QMK13_06535) - 1265528..1265878 (-) 351 WP_002788276.1 hypothetical protein -
  QMK13_RS06540 (QMK13_06540) - 1265879..1266421 (-) 543 WP_002800770.1 HK97 gp10 family phage protein -
  QMK13_RS06545 (QMK13_06545) - 1266418..1267590 (-) 1173 WP_002788272.1 phage portal protein -
  QMK13_RS06550 (QMK13_06550) - 1267750..1268184 (-) 435 WP_002913302.1 type II toxin-antitoxin system PemK/MazF family toxin -
  QMK13_RS06555 (QMK13_06555) - 1268239..1269864 (-) 1626 WP_002913304.1 terminase TerL endonuclease subunit -
  QMK13_RS06560 (QMK13_06560) - 1269868..1270506 (-) 639 WP_002913306.1 P27 family phage terminase small subunit -
  QMK13_RS06565 (QMK13_06565) - 1270757..1271107 (-) 351 WP_002869973.1 HNH endonuclease signature motif containing protein -
  QMK13_RS06570 (QMK13_06570) - 1271094..1271384 (-) 291 WP_002788257.1 hypothetical protein -
  QMK13_RS06580 (QMK13_06580) ktrB 1272128..1273471 (+) 1344 WP_002876757.1 TrkH family potassium uptake protein -
  QMK13_RS06585 (QMK13_06585) ktrA 1273482..1274132 (+) 651 WP_002853664.1 TrkA family potassium uptake protein -
  QMK13_RS06590 (QMK13_06590) - 1274129..1274800 (-) 672 WP_002854065.1 menaquinone biosynthetic enzyme MqnA/MqnD family protein -
  QMK13_RS06595 (QMK13_06595) upp 1274806..1275432 (-) 627 WP_002831283.1 uracil phosphoribosyltransferase -
  QMK13_RS06600 (QMK13_06600) - 1275429..1276664 (-) 1236 WP_002854063.1 malic enzyme-like NAD(P)-binding protein -
  QMK13_RS06605 (QMK13_06605) gltX 1276666..1278057 (-) 1392 WP_087686039.1 glutamate--tRNA ligase -
  QMK13_RS06610 (QMK13_06610) salC 1278122..1278937 (+) 816 WP_002937716.1 peptidylprolyl isomerase SalC -
  QMK13_RS06615 (QMK13_06615) accC 1278974..1280305 (-) 1332 WP_044778053.1 acetyl-CoA carboxylase biotin carboxylase subunit -
  QMK13_RS06620 (QMK13_06620) accB 1280307..1280762 (-) 456 WP_002866271.1 acetyl-CoA carboxylase biotin carboxyl carrier protein -
  QMK13_RS06625 (QMK13_06625) dcd 1280910..1281470 (+) 561 WP_057100672.1 dCTP deaminase -
  QMK13_RS06630 (QMK13_06630) pseB 1281519..1282523 (+) 1005 WP_057100673.1 UDP-N-acetylglucosamine 4,6-dehydratase (inverting) -

Sequence


Protein


Download         Length: 217 a.a.        Molecular weight: 25531.02 Da        Isoelectric Point: 9.8742

>NTDB_id=831843 QMK13_RS06410 WP_011049930.1 1245906..1246559(+) (CJE1441) [Campylobacter jejuni strain SKBC9]
MKKLIILSLLSTLAFADYTQYKPSEDFAKYFTKQNCSQVLDKFYYINCYDYSLKGTKAVAYRLEADNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGSLEVL
NLVNYDNNPQRIKNNIAIPSSYTKILKGDNFKECYQVPNHDVENENLRIYKVKCDNF

Nucleotide


Download         Length: 654 bp        

>NTDB_id=831843 QMK13_RS06410 WP_011049930.1 1245906..1246559(+) (CJE1441) [Campylobacter jejuni strain SKBC9]
ATGAAAAAACTTATAATCTTATCTTTATTATCCACTCTAGCTTTTGCTGATTATACACAATACAAACCAAGCGAAGATTT
TGCCAAGTATTTTACTAAACAAAACTGCTCACAAGTTTTGGATAAATTTTATTATATTAATTGTTATGATTATTCTTTAA
AAGGCACTAAAGCCGTAGCTTATAGATTAGAAGCGGATAATTTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATTCCTAAAAAATACCGCACCACATGGAGTGATTATAAAAACAGCGGTTACGACAGGGGACACACTCT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTTTTAATGAGCAACATTACTCCACAAAATCCAC
AAATCAATCAAAGAGTTTGGAATAAAATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAGCTTGGAAGTTTAGAAGTTTTA
AATTTGGTTAATTATGACAATAATCCACAAAGAATAAAAAACAATATTGCTATTCCAAGCTCTTACACTAAGATTTTAAA
AGGTGATAATTTTAAAGAATGTTACCAAGTGCCTAATCACGATGTAGAAAATGAGAATTTAAGAATATATAAAGTAAAAT
GTGACAATTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A3X8NAQ4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE1441 Campylobacter jejuni RM1221

100

100

1

  CJE0566 Campylobacter jejuni RM1221

91.163

99.078

0.903