Detailed information
Bioinformatically predicted
Overview
| Name | comS | Type | Regulator |
| Locus tag | H7680_RS10365 | Genome accession | NZ_AP023394 |
| Coordinates | 57709..57807 (+) | Length | 32 a.a. |
| NCBI ID | WP_014611913.1 | Uniprot ID | A0A380JYX6 |
| Organism | Streptococcus dysgalactiae subsp. equisimilis strain 159 | ||
| Function | activate transcription of comX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 45101..71029 | 57709..57807 | within | 0 |
Gene organization within MGE regions
Location: 45101..71029
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7680_RS00300 (SDSE159_00270) | purM | 45101..46129 (+) | 1029 | WP_003056406.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| H7680_RS00305 (SDSE159_00280) | purN | 46122..46676 (+) | 555 | WP_003056410.1 | phosphoribosylglycinamide formyltransferase | - |
| H7680_RS00310 (SDSE159_00290) | - | 46783..47266 (+) | 484 | Protein_28 | VanZ family protein | - |
| H7680_RS00315 (SDSE159_00300) | purH | 47285..48829 (+) | 1545 | WP_014611911.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| H7680_RS00320 (SDSE159_00310) | - | 48909..50036 (-) | 1128 | WP_003055557.1 | SH3 domain-containing protein | - |
| H7680_RS00325 (SDSE159_00320) | purD | 50319..51581 (+) | 1263 | WP_003055553.1 | phosphoribosylamine--glycine ligase | - |
| H7680_RS00330 (SDSE159_00330) | purE | 52212..52700 (+) | 489 | WP_003055559.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| H7680_RS00335 (SDSE159_00340) | purK | 52687..53760 (+) | 1074 | WP_003055561.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| H7680_RS00340 (SDSE159_00350) | - | 53770..55026 (+) | 1257 | WP_003055555.1 | DUF4041 domain-containing protein | - |
| H7680_RS00345 (SDSE159_00360) | - | 55019..55228 (+) | 210 | WP_014611912.1 | hypothetical protein | - |
| H7680_RS00350 (SDSE159_00370) | purB | 55277..56569 (+) | 1293 | WP_003056595.1 | adenylosuccinate lyase | - |
| H7680_RS00355 (SDSE159_00380) | comR | 56711..57622 (+) | 912 | WP_003060893.1 | XRE family transcriptional regulator | Regulator |
| H7680_RS10365 | comS | 57709..57807 (+) | 99 | WP_014611913.1 | quorum-sensing system DWW-type pheromone | Regulator |
| H7680_RS00360 (SDSE159_00390) | ruvB | 57841..58839 (+) | 999 | WP_003059357.1 | Holliday junction branch migration DNA helicase RuvB | - |
| H7680_RS00365 (SDSE159_00400) | - | 58974..59405 (+) | 432 | WP_003059365.1 | low molecular weight protein-tyrosine-phosphatase | - |
| H7680_RS00370 (SDSE159_00410) | - | 59434..59835 (+) | 402 | WP_003049089.1 | MORN repeat-containing protein | - |
| H7680_RS00375 (SDSE159_00420) | - | 59832..61607 (+) | 1776 | WP_003059359.1 | acyltransferase family protein | - |
| H7680_RS00380 (SDSE159_00430) | adhE | 61928..64570 (+) | 2643 | WP_003059363.1 | bifunctional acetaldehyde-CoA/alcohol dehydrogenase | - |
| H7680_RS00385 (SDSE159_00440) | adhP | 64863..65879 (+) | 1017 | WP_003059355.1 | alcohol dehydrogenase AdhP | - |
| H7680_RS00390 (SDSE159_00460) | thrC | 66071..67555 (+) | 1485 | WP_003059350.1 | threonine synthase | - |
| H7680_RS00395 (SDSE159_00470) | - | 67595..68884 (+) | 1290 | WP_014611915.1 | MATE family efflux transporter | - |
| H7680_RS00400 (SDSE159_00480) | - | 68954..69976 (-) | 1023 | WP_184006755.1 | IS30 family transposase | - |
| H7680_RS00405 (SDSE159_00490) | - | 70052..71029 (-) | 978 | WP_014611916.1 | IS30 family transposase | - |
Sequence
Protein
Download Length: 32 a.a. Molecular weight: 3771.59 Da Isoelectric Point: 10.4764
>NTDB_id=83089 H7680_RS10365 WP_014611913.1 57709..57807(+) (comS) [Streptococcus dysgalactiae subsp. equisimilis strain 159]
MFKKIKPYLLLAAVVAFKVARAMNEFDWWNLG
MFKKIKPYLLLAAVVAFKVARAMNEFDWWNLG
Nucleotide
Download Length: 99 bp
>NTDB_id=83089 H7680_RS10365 WP_014611913.1 57709..57807(+) (comS) [Streptococcus dysgalactiae subsp. equisimilis strain 159]
ATGTTTAAAAAAATCAAACCATATTTGTTATTAGCCGCAGTCGTTGCTTTCAAAGTTGCTCGTGCAATGAACGAATTTGA
TTGGTGGAACCTAGGGTGA
ATGTTTAAAAAAATCAAACCATATTTGTTATTAGCCGCAGTCGTTGCTTTCAAAGTTGCTCGTGCAATGAACGAATTTGA
TTGGTGGAACCTAGGGTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comS | Streptococcus pyogenes MGAS315 |
84.375 |
100 |
0.844 |
| comS | Streptococcus pyogenes MGAS8232 |
45.161 |
96.875 |
0.437 |