Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   QLX50_RS01965 Genome accession   NZ_CP125283
Coordinates   389105..389224 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain IFST-221     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 384105..394224
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLX50_RS01950 (QLX50_01950) - 385717..386400 (+) 684 WP_282999936.1 response regulator transcription factor -
  QLX50_RS01955 (QLX50_01955) - 386387..387814 (+) 1428 WP_282999937.1 HAMP domain-containing sensor histidine kinase -
  QLX50_RS01960 (QLX50_01960) rapC 387973..389121 (+) 1149 WP_029326229.1 Rap family tetratricopeptide repeat protein Regulator
  QLX50_RS01965 (QLX50_01965) phrC 389105..389224 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  QLX50_RS01970 (QLX50_01970) - 389374..389469 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  QLX50_RS01975 (QLX50_01975) - 389564..390928 (-) 1365 WP_007609394.1 aspartate kinase -
  QLX50_RS01980 (QLX50_01980) ceuB 391342..392295 (+) 954 WP_032872883.1 ABC transporter permease Machinery gene
  QLX50_RS01985 (QLX50_01985) - 392285..393232 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  QLX50_RS01990 (QLX50_01990) - 393226..393984 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=830586 QLX50_RS01965 WP_003156334.1 389105..389224(+) (phrC) [Bacillus velezensis strain IFST-221]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=830586 QLX50_RS01965 WP_003156334.1 389105..389224(+) (phrC) [Bacillus velezensis strain IFST-221]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718