Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   QLQ40_RS12835 Genome accession   NZ_CP124935
Coordinates   2583006..2583533 (-) Length   175 a.a.
NCBI ID   WP_021732903.1    Uniprot ID   -
Organism   Enterococcus faecalis strain EfsPF23     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2550083..2593412 2583006..2583533 within 0


Gene organization within MGE regions


Location: 2550083..2593412
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLQ40_RS12600 (QLQ40_12600) - 2550083..2550574 (-) 492 WP_002355129.1 gamma carbonic anhydrase family protein -
  QLQ40_RS12605 (QLQ40_12605) efrB 2550817..2552586 (-) 1770 WP_002365186.1 multidrug efflux ABC transporter subunit EfrB -
  QLQ40_RS12610 (QLQ40_12610) efrA 2552583..2554310 (-) 1728 WP_010710228.1 multidrug efflux ABC transporter subunit EfrA -
  QLQ40_RS12615 (QLQ40_12615) - 2554539..2554925 (+) 387 WP_002355126.1 YbaN family protein -
  QLQ40_RS12620 (QLQ40_12620) - 2555231..2555443 (+) 213 WP_002355123.1 DNA-directed RNA polymerase subunit epsilon -
  QLQ40_RS12625 (QLQ40_12625) - 2555445..2557130 (+) 1686 WP_002355122.1 ribonuclease J -
  QLQ40_RS12630 (QLQ40_12630) - 2557236..2557436 (-) 201 WP_002355121.1 cold-shock protein -
  QLQ40_RS12635 (QLQ40_12635) - 2557590..2557754 (-) 165 Protein_2465 JAB domain-containing protein -
  QLQ40_RS12640 (QLQ40_12640) - 2557821..2559062 (-) 1242 WP_048951791.1 LysM peptidoglycan-binding domain-containing protein -
  QLQ40_RS12645 (QLQ40_12645) - 2559063..2559296 (-) 234 WP_002417568.1 phage holin -
  QLQ40_RS12650 (QLQ40_12650) - 2559289..2559510 (-) 222 WP_002374005.1 hypothetical protein -
  QLQ40_RS12655 (QLQ40_12655) - 2559545..2559682 (-) 138 WP_021732961.1 XkdX family protein -
  QLQ40_RS12660 (QLQ40_12660) - 2559682..2560056 (-) 375 WP_010815471.1 hypothetical protein -
  QLQ40_RS12665 (QLQ40_12665) - 2560071..2560583 (-) 513 WP_021732963.1 hypothetical protein -
  QLQ40_RS12670 (QLQ40_12670) - 2560583..2560900 (-) 318 WP_021732960.1 hypothetical protein -
  QLQ40_RS12675 (QLQ40_12675) - 2560893..2561210 (-) 318 WP_021732959.1 hypothetical protein -
  QLQ40_RS12680 (QLQ40_12680) - 2561203..2562111 (-) 909 WP_048951792.1 phage baseplate upper protein -
  QLQ40_RS12685 (QLQ40_12685) - 2562130..2564967 (-) 2838 WP_048951793.1 phage tail tip lysozyme -
  QLQ40_RS12690 (QLQ40_12690) - 2564964..2565668 (-) 705 WP_010817424.1 hypothetical protein -
  QLQ40_RS12695 (QLQ40_12695) - 2565671..2567968 (-) 2298 WP_010817425.1 phage tail tape measure protein -
  QLQ40_RS12700 (QLQ40_12700) - 2568160..2568615 (-) 456 WP_002395308.1 hypothetical protein -
  QLQ40_RS12705 (QLQ40_12705) - 2568615..2569262 (-) 648 WP_010784938.1 major tail protein -
  QLQ40_RS12710 (QLQ40_12710) - 2569259..2569621 (-) 363 WP_002395306.1 HK97-gp10 family putative phage morphogenesis protein -
  QLQ40_RS12715 (QLQ40_12715) - 2569611..2569949 (-) 339 WP_021732923.1 hypothetical protein -
  QLQ40_RS12720 (QLQ40_12720) - 2569939..2570265 (-) 327 WP_010817427.1 phage head closure protein -
  QLQ40_RS12725 (QLQ40_12725) - 2570225..2570512 (-) 288 WP_021732917.1 phage head-tail connector protein -
  QLQ40_RS12730 (QLQ40_12730) - 2570515..2571846 (-) 1332 WP_021732912.1 phage major capsid protein -
  QLQ40_RS12735 (QLQ40_12735) - 2571846..2572430 (-) 585 WP_002398477.1 HK97 family phage prohead protease -
  QLQ40_RS12740 (QLQ40_12740) - 2572414..2573583 (-) 1170 WP_010774948.1 phage portal protein -
  QLQ40_RS12745 (QLQ40_12745) - 2573602..2575335 (-) 1734 WP_002398479.1 terminase large subunit -
  QLQ40_RS12750 (QLQ40_12750) - 2575332..2575790 (-) 459 WP_002398480.1 P27 family phage terminase small subunit -
  QLQ40_RS12755 (QLQ40_12755) - 2575894..2576193 (-) 300 WP_214280393.1 HNH endonuclease -
  QLQ40_RS12760 (QLQ40_12760) - 2576270..2576557 (-) 288 WP_002406251.1 hypothetical protein -
  QLQ40_RS12770 (QLQ40_12770) - 2577360..2577779 (-) 420 WP_021732922.1 phage transcriptional regulator, RinA family -
  QLQ40_RS12775 (QLQ40_12775) - 2577780..2578019 (-) 240 WP_021732921.1 hypothetical protein -
  QLQ40_RS12780 (QLQ40_12780) - 2578016..2578222 (-) 207 WP_021732920.1 hypothetical protein -
  QLQ40_RS15450 - 2578405..2578659 (-) 255 WP_080349107.1 DUF1642 domain-containing protein -
  QLQ40_RS15455 - 2578765..2579145 (-) 381 Protein_2495 DUF1642 domain-containing protein -
  QLQ40_RS12790 (QLQ40_12790) - 2579159..2579341 (-) 183 WP_002403753.1 hypothetical protein -
  QLQ40_RS12795 (QLQ40_12795) - 2579338..2579556 (-) 219 WP_005876792.1 hypothetical protein -
  QLQ40_RS12800 (QLQ40_12800) - 2579568..2579846 (-) 279 WP_002406172.1 hypothetical protein -
  QLQ40_RS12805 (QLQ40_12805) - 2579847..2580206 (-) 360 WP_002406171.1 hypothetical protein -
  QLQ40_RS12810 (QLQ40_12810) - 2580203..2580610 (-) 408 WP_033624388.1 YopX family protein -
  QLQ40_RS12815 (QLQ40_12815) - 2580633..2581073 (-) 441 WP_002370000.1 restriction endonuclease subunit S -
  QLQ40_RS12820 (QLQ40_12820) - 2581070..2582386 (-) 1317 WP_021732910.1 N-6 DNA methylase -
  QLQ40_RS12825 (QLQ40_12825) - 2582439..2582645 (-) 207 WP_002395813.1 hypothetical protein -
  QLQ40_RS12830 (QLQ40_12830) - 2582665..2582994 (-) 330 WP_015543839.1 hypothetical protein -
  QLQ40_RS12835 (QLQ40_12835) ssb 2583006..2583533 (-) 528 WP_021732903.1 single-stranded DNA-binding protein Machinery gene
  QLQ40_RS12840 (QLQ40_12840) - 2583523..2583831 (-) 309 WP_010822654.1 MazG-like family protein -
  QLQ40_RS12845 (QLQ40_12845) - 2583836..2584678 (-) 843 WP_033624390.1 hypothetical protein -
  QLQ40_RS12850 (QLQ40_12850) - 2584698..2585339 (-) 642 WP_021732904.1 putative HNHc nuclease -
  QLQ40_RS12855 (QLQ40_12855) - 2585336..2586274 (-) 939 WP_021732905.1 DUF1351 domain-containing protein -
  QLQ40_RS12860 (QLQ40_12860) - 2586274..2587017 (-) 744 WP_021732914.1 ERF family protein -
  QLQ40_RS12865 (QLQ40_12865) - 2587266..2587820 (+) 555 WP_033624386.1 hypothetical protein -
  QLQ40_RS12870 (QLQ40_12870) - 2587801..2588007 (-) 207 WP_033624385.1 hypothetical protein -
  QLQ40_RS12875 (QLQ40_12875) - 2588104..2588277 (-) 174 WP_033624384.1 hypothetical protein -
  QLQ40_RS12880 (QLQ40_12880) - 2588289..2588474 (-) 186 WP_021732908.1 hypothetical protein -
  QLQ40_RS12885 (QLQ40_12885) - 2588485..2589195 (-) 711 WP_021732906.1 Rha family transcriptional regulator -
  QLQ40_RS12890 (QLQ40_12890) - 2589149..2589310 (-) 162 WP_021732902.1 hypothetical protein -
  QLQ40_RS12895 (QLQ40_12895) - 2589321..2589497 (-) 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
  QLQ40_RS12900 (QLQ40_12900) - 2589806..2590150 (+) 345 WP_010731661.1 helix-turn-helix domain-containing protein -
  QLQ40_RS12905 (QLQ40_12905) - 2590165..2590803 (+) 639 WP_010731662.1 ImmA/IrrE family metallo-endopeptidase -
  QLQ40_RS12910 (QLQ40_12910) - 2590825..2591370 (+) 546 WP_010731663.1 hypothetical protein -
  QLQ40_RS12915 (QLQ40_12915) - 2591472..2592839 (+) 1368 WP_021732907.1 recombinase family protein -
  QLQ40_RS12920 (QLQ40_12920) radC 2592864..2593412 (-) 549 Protein_2522 DNA repair protein RadC -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19369.24 Da        Isoelectric Point: 4.5778

>NTDB_id=829586 QLQ40_RS12835 WP_021732903.1 2583006..2583533(-) (ssb) [Enterococcus faecalis strain EfsPF23]
MINNVVLVGRLTKDPDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYTRKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEPKSANENRNSIQMSQNDGTSVQNNFEGNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=829586 QLQ40_RS12835 WP_021732903.1 2583006..2583533(-) (ssb) [Enterococcus faecalis strain EfsPF23]
ATGATAAATAATGTGGTATTAGTCGGAAGATTGACAAAAGATCCTGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATACTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGCCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGATGTCACAGAATGACGGTACAAGCGTTCAAAACAATTTCGAGGGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

57.979

100

0.623
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.286

100

0.583
  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

60.571

0.366