Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | QKW11_RS12330 | Genome accession | NZ_CP124851 |
| Coordinates | 2564924..2565097 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SF305 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2559924..2570097
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW11_RS12315 (QKW11_12310) | gcvT | 2560737..2561837 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| QKW11_RS12320 (QKW11_12315) | - | 2562261..2563931 (+) | 1671 | WP_015417810.1 | DEAD/DEAH box helicase | - |
| QKW11_RS12325 (QKW11_12320) | - | 2563953..2564747 (+) | 795 | WP_156240427.1 | YqhG family protein | - |
| QKW11_RS12330 (QKW11_12325) | sinI | 2564924..2565097 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| QKW11_RS12335 (QKW11_12330) | sinR | 2565131..2565466 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| QKW11_RS12340 (QKW11_12335) | tasA | 2565514..2566299 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| QKW11_RS12345 (QKW11_12340) | sipW | 2566364..2566948 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| QKW11_RS12350 (QKW11_12345) | tapA | 2566920..2567591 (-) | 672 | WP_113766732.1 | amyloid fiber anchoring/assembly protein TapA | - |
| QKW11_RS12355 (QKW11_12350) | - | 2567850..2568179 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| QKW11_RS12360 (QKW11_12355) | - | 2568220..2568399 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| QKW11_RS12365 (QKW11_12360) | comGG | 2568456..2568833 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| QKW11_RS12370 (QKW11_12365) | comGF | 2568834..2569334 (-) | 501 | WP_256683588.1 | competence type IV pilus minor pilin ComGF | - |
| QKW11_RS12375 (QKW11_12370) | comGE | 2569243..2569557 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| QKW11_RS12380 (QKW11_12375) | comGD | 2569541..2569978 (-) | 438 | WP_256683589.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=828370 QKW11_RS12330 WP_003153105.1 2564924..2565097(+) (sinI) [Bacillus velezensis strain SF305]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=828370 QKW11_RS12330 WP_003153105.1 2564924..2565097(+) (sinI) [Bacillus velezensis strain SF305]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |