Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QI003_RS19225 Genome accession   NZ_CP124601
Coordinates   3810941..3811081 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus stercoris strain BS21     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3805941..3816081
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QI003_RS19200 (QI003_19200) - 3806292..3806672 (-) 381 WP_040081970.1 hotdog fold thioesterase -
  QI003_RS19205 (QI003_19205) comA 3806690..3807334 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QI003_RS19210 (QI003_19210) comP 3807415..3809712 (-) 2298 WP_134975177.1 histidine kinase Regulator
  QI003_RS19215 (QI003_19215) comX 3809720..3809881 (-) 162 WP_003241045.1 competence pheromone ComX -
  QI003_RS19220 (QI003_19220) - 3809896..3810756 (-) 861 WP_071580795.1 polyprenyl synthetase family protein -
  QI003_RS19225 (QI003_19225) degQ 3810941..3811081 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QI003_RS19230 (QI003_19230) - 3811303..3811428 (+) 126 WP_128422565.1 hypothetical protein -
  QI003_RS19235 (QI003_19235) - 3811543..3811911 (+) 369 WP_014665193.1 hypothetical protein -
  QI003_RS19240 (QI003_19240) pdeH 3811887..3813116 (-) 1230 WP_014665194.1 cyclic di-GMP phosphodiesterase -
  QI003_RS19245 (QI003_19245) - 3813252..3814724 (-) 1473 WP_014665195.1 nicotinate phosphoribosyltransferase -
  QI003_RS19250 (QI003_19250) - 3814740..3815291 (-) 552 WP_014665196.1 isochorismatase family cysteine hydrolase -
  QI003_RS19255 (QI003_19255) - 3815388..3815786 (-) 399 WP_071580796.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=826648 QI003_RS19225 WP_003220708.1 3810941..3811081(-) (degQ) [Bacillus stercoris strain BS21]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=826648 QI003_RS19225 WP_003220708.1 3810941..3811081(-) (degQ) [Bacillus stercoris strain BS21]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATCGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1