Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QH639_RS04880 | Genome accession | NZ_CP123966 |
| Coordinates | 930494..931000 (+) | Length | 168 a.a. |
| NCBI ID | WP_281115718.1 | Uniprot ID | - |
| Organism | Lysinibacillus sp. | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 916486..954876 | 930494..931000 | within | 0 |
Gene organization within MGE regions
Location: 916486..954876
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QH639_RS04755 (QH639_04755) | - | 916486..917646 (-) | 1161 | WP_281115695.1 | site-specific integrase | - |
| QH639_RS04760 (QH639_04760) | - | 917887..918792 (-) | 906 | WP_281115696.1 | hypothetical protein | - |
| QH639_RS04765 (QH639_04765) | - | 918857..919651 (-) | 795 | WP_281115697.1 | hypothetical protein | - |
| QH639_RS04770 (QH639_04770) | - | 919670..920107 (-) | 438 | WP_281115698.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QH639_RS04775 (QH639_04775) | - | 920126..920611 (-) | 486 | WP_281115699.1 | helix-turn-helix transcriptional regulator | - |
| QH639_RS04780 (QH639_04780) | - | 920782..921027 (+) | 246 | WP_281115700.1 | helix-turn-helix transcriptional regulator | - |
| QH639_RS04785 (QH639_04785) | - | 921072..921851 (+) | 780 | WP_281115701.1 | phage antirepressor | - |
| QH639_RS04790 (QH639_04790) | - | 921848..922132 (+) | 285 | WP_281115702.1 | hypothetical protein | - |
| QH639_RS04795 (QH639_04795) | - | 922364..922882 (+) | 519 | WP_237898391.1 | helix-turn-helix transcriptional regulator | - |
| QH639_RS04800 (QH639_04800) | - | 922879..923121 (+) | 243 | WP_281115703.1 | hypothetical protein | - |
| QH639_RS04805 (QH639_04805) | - | 923105..923239 (+) | 135 | WP_281115704.1 | hypothetical protein | - |
| QH639_RS04810 (QH639_04810) | - | 923540..923770 (+) | 231 | WP_281115705.1 | hypothetical protein | - |
| QH639_RS04815 (QH639_04815) | - | 923839..924768 (+) | 930 | WP_281115706.1 | lambda-exonuclease family protein | - |
| QH639_RS04820 (QH639_04820) | - | 924770..924961 (+) | 192 | WP_281115707.1 | hypothetical protein | - |
| QH639_RS04825 (QH639_04825) | - | 924963..925205 (+) | 243 | WP_281115708.1 | hypothetical protein | - |
| QH639_RS04830 (QH639_04830) | recT | 925208..926011 (+) | 804 | WP_281115709.1 | recombination protein RecT | - |
| QH639_RS04835 (QH639_04835) | - | 926004..926177 (+) | 174 | WP_281115710.1 | hypothetical protein | - |
| QH639_RS04840 (QH639_04840) | - | 926204..927172 (+) | 969 | WP_281115711.1 | site-specific DNA-methyltransferase | - |
| QH639_RS04845 (QH639_04845) | - | 927241..927468 (+) | 228 | WP_131521407.1 | hypothetical protein | - |
| QH639_RS04850 (QH639_04850) | - | 927484..928404 (+) | 921 | WP_281115712.1 | DnaD domain protein | - |
| QH639_RS04855 (QH639_04855) | zapE | 928340..929164 (+) | 825 | WP_281115713.1 | AFG1/ZapE family ATPase | - |
| QH639_RS04860 (QH639_04860) | - | 929197..929697 (+) | 501 | WP_281115714.1 | hypothetical protein | - |
| QH639_RS04865 (QH639_04865) | - | 929690..929878 (+) | 189 | WP_281115715.1 | hypothetical protein | - |
| QH639_RS04870 (QH639_04870) | - | 929875..930114 (+) | 240 | WP_281115716.1 | hypothetical protein | - |
| QH639_RS04875 (QH639_04875) | - | 930111..930497 (+) | 387 | WP_281115717.1 | hypothetical protein | - |
| QH639_RS04880 (QH639_04880) | ssbA | 930494..931000 (+) | 507 | WP_281115718.1 | single-stranded DNA-binding protein | Machinery gene |
| QH639_RS04885 (QH639_04885) | - | 931019..931198 (+) | 180 | WP_281115719.1 | hypothetical protein | - |
| QH639_RS04890 (QH639_04890) | - | 931195..931518 (+) | 324 | WP_279495694.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| QH639_RS04895 (QH639_04895) | - | 931533..931703 (+) | 171 | WP_279495693.1 | hypothetical protein | - |
| QH639_RS04900 (QH639_04900) | - | 931780..932196 (+) | 417 | WP_281115720.1 | DUF1064 domain-containing protein | - |
| QH639_RS04905 (QH639_04905) | - | 932449..932673 (+) | 225 | WP_281115721.1 | hypothetical protein | - |
| QH639_RS04910 (QH639_04910) | - | 932725..933360 (+) | 636 | WP_281115722.1 | hypothetical protein | - |
| QH639_RS04915 (QH639_04915) | - | 933754..934173 (+) | 420 | WP_227744983.1 | hypothetical protein | - |
| QH639_RS04920 (QH639_04920) | - | 934212..934667 (-) | 456 | WP_131522014.1 | hypothetical protein | - |
| QH639_RS04925 (QH639_04925) | - | 935257..935481 (+) | 225 | WP_281115723.1 | hypothetical protein | - |
| QH639_RS04930 (QH639_04930) | - | 935635..935964 (+) | 330 | WP_281115724.1 | YjcQ family protein | - |
| QH639_RS04935 (QH639_04935) | - | 936161..936316 (+) | 156 | WP_281115725.1 | hypothetical protein | - |
| QH639_RS04940 (QH639_04940) | - | 936380..937153 (+) | 774 | WP_281115726.1 | hypothetical protein | - |
| QH639_RS04945 (QH639_04945) | - | 937150..938415 (+) | 1266 | WP_281115727.1 | PBSX family phage terminase large subunit | - |
| QH639_RS04950 (QH639_04950) | - | 938428..939987 (+) | 1560 | WP_281115728.1 | phage portal protein | - |
| QH639_RS04955 (QH639_04955) | - | 939984..941003 (+) | 1020 | WP_281115729.1 | phage minor head protein | - |
| QH639_RS04960 (QH639_04960) | - | 941006..941416 (+) | 411 | WP_281115730.1 | hypothetical protein | - |
| QH639_RS04965 (QH639_04965) | - | 941458..941742 (+) | 285 | WP_258860544.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QH639_RS04970 (QH639_04970) | - | 941789..942019 (+) | 231 | WP_281115731.1 | hypothetical protein | - |
| QH639_RS04975 (QH639_04975) | - | 942198..942428 (+) | 231 | WP_258860542.1 | hypothetical protein | - |
| QH639_RS04980 (QH639_04980) | - | 942533..943204 (+) | 672 | WP_281115732.1 | DUF4355 domain-containing protein | - |
| QH639_RS04985 (QH639_04985) | - | 943234..944097 (+) | 864 | WP_281115733.1 | P22 phage major capsid protein family protein | - |
| QH639_RS04990 (QH639_04990) | - | 944110..944268 (+) | 159 | WP_281115734.1 | hypothetical protein | - |
| QH639_RS04995 (QH639_04995) | - | 944277..944603 (+) | 327 | WP_281115735.1 | hypothetical protein | - |
| QH639_RS05000 (QH639_05000) | - | 944590..944913 (+) | 324 | WP_281115736.1 | phage head closure protein | - |
| QH639_RS05005 (QH639_05005) | - | 944913..945329 (+) | 417 | WP_281115737.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QH639_RS05010 (QH639_05010) | - | 945326..945769 (+) | 444 | WP_281115738.1 | DUF3168 domain-containing protein | - |
| QH639_RS05015 (QH639_05015) | - | 945813..946580 (+) | 768 | WP_281115739.1 | phage major tail protein, TP901-1 family | - |
| QH639_RS05020 (QH639_05020) | - | 946641..947090 (+) | 450 | WP_281115740.1 | tail assembly chaperone | - |
| QH639_RS05025 (QH639_05025) | - | 947126..947437 (+) | 312 | WP_131522660.1 | hypothetical protein | - |
| QH639_RS05030 (QH639_05030) | - | 947443..952962 (+) | 5520 | WP_281115741.1 | hypothetical protein | - |
| QH639_RS05035 (QH639_05035) | - | 952976..953839 (+) | 864 | WP_281115742.1 | phage tail family protein | - |
| QH639_RS05040 (QH639_05040) | - | 953851..954876 (+) | 1026 | WP_281115743.1 | phage tail protein | - |
Sequence
Protein
Download Length: 168 a.a. Molecular weight: 18574.36 Da Isoelectric Point: 4.7306
>NTDB_id=823313 QH639_RS04880 WP_281115718.1 930494..931000(+) (ssbA) [Lysinibacillus sp.]
MINRVVLVGRLTKDIDLSYTPQGIAKAQFTLAVNRSFANQSGEREADFIQIQAWRKQAENAANYLKKGSMVGIDGKIQTG
SYERDGQRIYFTNVVADSIQFLEPRNSTGGPQGMTDYQSSTNTAGQYQGSSQGQYGGQNNQPSYTRVDEDPFANSKEPIE
VNSDDLPF
MINRVVLVGRLTKDIDLSYTPQGIAKAQFTLAVNRSFANQSGEREADFIQIQAWRKQAENAANYLKKGSMVGIDGKIQTG
SYERDGQRIYFTNVVADSIQFLEPRNSTGGPQGMTDYQSSTNTAGQYQGSSQGQYGGQNNQPSYTRVDEDPFANSKEPIE
VNSDDLPF
Nucleotide
Download Length: 507 bp
>NTDB_id=823313 QH639_RS04880 WP_281115718.1 930494..931000(+) (ssbA) [Lysinibacillus sp.]
ATGATTAACCGAGTCGTATTAGTTGGCCGACTTACTAAAGATATTGACCTTTCCTATACACCTCAAGGCATTGCAAAGGC
TCAATTTACTTTAGCAGTTAACAGGTCTTTCGCTAACCAAAGTGGTGAAAGAGAAGCAGATTTTATCCAGATTCAAGCTT
GGCGCAAGCAGGCAGAGAATGCAGCCAACTATCTCAAGAAAGGGTCCATGGTTGGGATTGATGGAAAGATACAAACAGGT
TCGTATGAGAGAGACGGGCAAAGAATCTATTTTACGAACGTTGTAGCAGACAGCATCCAATTCTTAGAGCCGAGAAACAG
CACAGGAGGCCCGCAGGGAATGACAGACTATCAATCTAGTACAAATACAGCTGGACAGTATCAAGGCAGTTCACAGGGGC
AATATGGCGGTCAAAACAACCAGCCAAGTTATACAAGGGTCGATGAAGATCCTTTTGCTAATAGTAAGGAGCCGATTGAG
GTTAATTCGGACGATTTACCTTTCTAA
ATGATTAACCGAGTCGTATTAGTTGGCCGACTTACTAAAGATATTGACCTTTCCTATACACCTCAAGGCATTGCAAAGGC
TCAATTTACTTTAGCAGTTAACAGGTCTTTCGCTAACCAAAGTGGTGAAAGAGAAGCAGATTTTATCCAGATTCAAGCTT
GGCGCAAGCAGGCAGAGAATGCAGCCAACTATCTCAAGAAAGGGTCCATGGTTGGGATTGATGGAAAGATACAAACAGGT
TCGTATGAGAGAGACGGGCAAAGAATCTATTTTACGAACGTTGTAGCAGACAGCATCCAATTCTTAGAGCCGAGAAACAG
CACAGGAGGCCCGCAGGGAATGACAGACTATCAATCTAGTACAAATACAGCTGGACAGTATCAAGGCAGTTCACAGGGGC
AATATGGCGGTCAAAACAACCAGCCAAGTTATACAAGGGTCGATGAAGATCCTTTTGCTAATAGTAAGGAGCCGATTGAG
GTTAATTCGGACGATTTACCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.56 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.419 |
100 |
0.506 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
63.095 |
0.363 |