Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   PH204_RS06485 Genome accession   NZ_CP122953
Coordinates   1372427..1372540 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain BS30     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1367427..1377540
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PH204_RS06465 (PH204_06465) - 1368111..1369523 (-) 1413 WP_286446971.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  PH204_RS06470 (PH204_06470) comB10 1369593..1370732 (-) 1140 WP_286446972.1 DNA type IV secretion system protein ComB10 Machinery gene
  PH204_RS06475 (PH204_06475) comB9 1370725..1371687 (-) 963 WP_286446973.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  PH204_RS06480 (PH204_06480) comB8 1371687..1372430 (-) 744 WP_286446975.1 virB8 family protein Machinery gene
  PH204_RS06485 (PH204_06485) comB7 1372427..1372540 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  PH204_RS06490 (PH204_06490) comB6 1372556..1373611 (-) 1056 WP_286447846.1 P-type conjugative transfer protein TrbL Machinery gene
  PH204_RS06495 (PH204_06495) - 1373619..1374614 (-) 996 WP_286446978.1 PDZ domain-containing protein -
  PH204_RS06500 (PH204_06500) - 1374614..1374916 (-) 303 WP_181229633.1 YbaB/EbfC family nucleoid-associated protein -
  PH204_RS06505 (PH204_06505) panD 1374919..1375272 (-) 354 WP_000142243.1 aspartate 1-decarboxylase -
  PH204_RS06510 (PH204_06510) - 1375262..1377487 (-) 2226 WP_286446982.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=817430 PH204_RS06485 WP_001217873.1 1372427..1372540(-) (comB7) [Helicobacter pylori strain BS30]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=817430 PH204_RS06485 WP_001217873.1 1372427..1372540(-) (comB7) [Helicobacter pylori strain BS30]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1