Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QAP00_RS00710 Genome accession   NZ_CP122949
Coordinates   148951..149076 (+) Length   41 a.a.
NCBI ID   WP_309256602.1    Uniprot ID   -
Organism   Helicobacter pylori strain BS22     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 143951..154076
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAP00_RS00685 (QAP00_00685) - 144009..146231 (+) 2223 WP_309256599.1 ATP-dependent Clp protease ATP-binding subunit -
  QAP00_RS00690 (QAP00_00690) panD 146221..146574 (+) 354 WP_309256600.1 aspartate 1-decarboxylase -
  QAP00_RS00695 (QAP00_00695) - 146577..146870 (+) 294 WP_309256601.1 YbaB/EbfC family nucleoid-associated protein -
  QAP00_RS00700 (QAP00_00700) - 146870..147874 (+) 1005 WP_309257032.1 PDZ domain-containing protein -
  QAP00_RS00705 (QAP00_00705) comB6 147880..148935 (+) 1056 WP_309257033.1 P-type conjugative transfer protein TrbL Machinery gene
  QAP00_RS00710 (QAP00_00710) comB7 148951..149076 (+) 126 WP_309256602.1 comB7 lipoprotein Machinery gene
  QAP00_RS00715 (QAP00_00715) comB8 149073..149810 (+) 738 WP_309256603.1 virB8 family protein Machinery gene
  QAP00_RS00720 (QAP00_00720) comB9 149810..150778 (+) 969 WP_309256604.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAP00_RS00725 (QAP00_00725) comB10 150771..151907 (+) 1137 WP_309256605.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAP00_RS00730 (QAP00_00730) - 151977..153389 (+) 1413 WP_309256606.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4710.71 Da        Isoelectric Point: 9.3013

>NTDB_id=817333 QAP00_RS00710 WP_309256602.1 148951..149076(+) (comB7) [Helicobacter pylori strain BS22]
MKIFSVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=817333 QAP00_RS00710 WP_309256602.1 148951..149076(+) (comB7) [Helicobacter pylori strain BS22]
ATGAAAATTTTTTCTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829