Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QAD57_RS04345 Genome accession   NZ_CP122947
Coordinates   926539..926664 (-) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain BS07     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 921539..931664
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAD57_RS04325 (QAD57_04320) - 922232..923644 (-) 1413 WP_286445305.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  QAD57_RS04330 (QAD57_04325) comB10 923714..924850 (-) 1137 WP_286445306.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAD57_RS04335 (QAD57_04330) comB9 924843..925805 (-) 963 WP_286445307.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAD57_RS04340 (QAD57_04335) comB8 925805..926542 (-) 738 WP_075708163.1 virB8 family protein Machinery gene
  QAD57_RS04345 (QAD57_04340) comB7 926539..926664 (-) 126 WP_001217867.1 hypothetical protein Machinery gene
  QAD57_RS04350 (QAD57_04345) comB6 926680..927735 (-) 1056 WP_286445309.1 P-type conjugative transfer protein TrbL Machinery gene
  QAD57_RS04355 (QAD57_04350) - 927741..928736 (-) 996 WP_286446347.1 PDZ domain-containing protein -
  QAD57_RS04360 (QAD57_04355) - 928736..929029 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  QAD57_RS04365 (QAD57_04360) panD 929040..929390 (-) 351 WP_180454389.1 aspartate 1-decarboxylase -
  QAD57_RS04370 (QAD57_04365) - 929380..931605 (-) 2226 WP_286445310.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=817295 QAD57_RS04345 WP_001217867.1 926539..926664(-) (comB7) [Helicobacter pylori strain BS07]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=817295 QAD57_RS04345 WP_001217867.1 926539..926664(-) (comB7) [Helicobacter pylori strain BS07]
ATGAGAATTTTTTTTGTTATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829