Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QAP07_RS00945 Genome accession   NZ_CP122946
Coordinates   199390..199503 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori strain BS31     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 194390..204503
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAP07_RS00920 (QAP07_00920) - 194452..196677 (+) 2226 WP_286444681.1 ATP-dependent Clp protease ATP-binding subunit -
  QAP07_RS00925 (QAP07_00925) panD 196667..197020 (+) 354 WP_286444682.1 aspartate 1-decarboxylase -
  QAP07_RS00930 (QAP07_00930) - 197023..197316 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  QAP07_RS00935 (QAP07_00935) - 197316..198311 (+) 996 WP_286445124.1 PDZ domain-containing protein -
  QAP07_RS00940 (QAP07_00940) comB6 198319..199374 (+) 1056 WP_286445125.1 P-type conjugative transfer protein TrbL Machinery gene
  QAP07_RS00945 (QAP07_00945) comB7 199390..199503 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  QAP07_RS00950 (QAP07_00950) comB8 199500..200243 (+) 744 WP_286444683.1 virB8 family protein Machinery gene
  QAP07_RS00955 (QAP07_00955) comB9 200243..201226 (+) 984 WP_286444684.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAP07_RS00960 (QAP07_00960) comB10 201219..202355 (+) 1137 WP_286444685.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAP07_RS00965 (QAP07_00965) - 202425..203837 (+) 1413 WP_286444687.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=817269 QAP07_RS00945 WP_001217877.1 199390..199503(+) (comB7) [Helicobacter pylori strain BS31]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=817269 QAP07_RS00945 WP_001217877.1 199390..199503(+) (comB7) [Helicobacter pylori strain BS31]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973