Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QCM05_RS03500 Genome accession   NZ_CP122515
Coordinates   717078..717203 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain HP22     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 712078..722203
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QCM05_RS03475 (QCM05_03475) - 712137..714362 (+) 2226 WP_279963450.1 ATP-dependent Clp protease ATP-binding subunit -
  QCM05_RS03480 (QCM05_03480) panD 714352..714702 (+) 351 WP_073470207.1 aspartate 1-decarboxylase -
  QCM05_RS03485 (QCM05_03485) - 714713..715006 (+) 294 WP_131128566.1 YbaB/EbfC family nucleoid-associated protein -
  QCM05_RS03490 (QCM05_03490) - 715006..716001 (+) 996 WP_279963507.1 PDZ domain-containing protein -
  QCM05_RS03495 (QCM05_03495) comB6 716007..717062 (+) 1056 WP_279963508.1 P-type conjugative transfer protein TrbL Machinery gene
  QCM05_RS03500 (QCM05_03500) comB7 717078..717203 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  QCM05_RS03505 (QCM05_03505) comB8 717200..717937 (+) 738 WP_279963451.1 virB8 family protein Machinery gene
  QCM05_RS03510 (QCM05_03510) comB9 717937..718899 (+) 963 WP_279963452.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QCM05_RS03515 (QCM05_03515) comB10 718892..720028 (+) 1137 WP_279963453.1 DNA type IV secretion system protein ComB10 Machinery gene
  QCM05_RS03520 (QCM05_03520) - 720098..721510 (+) 1413 WP_279963454.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=816243 QCM05_RS03500 WP_001217874.1 717078..717203(+) (comB7) [Helicobacter pylori strain HP22]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=816243 QCM05_RS03500 WP_001217874.1 717078..717203(+) (comB7) [Helicobacter pylori strain HP22]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACTAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878