Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   QA442_RS05885 Genome accession   NZ_CP121861
Coordinates   1139537..1139677 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus stercoris strain Mal05     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1134537..1144677
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QA442_RS05855 (QA442_05855) - 1134832..1135230 (+) 399 WP_095431808.1 YueI family protein -
  QA442_RS05860 (QA442_05860) - 1135327..1135878 (+) 552 WP_095431807.1 isochorismatase family cysteine hydrolase -
  QA442_RS05865 (QA442_05865) - 1135894..1137366 (+) 1473 WP_095431806.1 nicotinate phosphoribosyltransferase -
  QA442_RS05870 (QA442_05870) pdeH 1137502..1138731 (+) 1230 WP_014665194.1 cyclic di-GMP phosphodiesterase -
  QA442_RS05875 (QA442_05875) - 1138707..1139075 (-) 369 WP_014665193.1 hypothetical protein -
  QA442_RS05880 (QA442_05880) - 1139190..1139315 (-) 126 WP_128422565.1 hypothetical protein -
  QA442_RS05885 (QA442_05885) degQ 1139537..1139677 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QA442_RS05890 (QA442_05890) - 1139861..1140721 (+) 861 WP_095431805.1 polyprenyl synthetase family protein -
  QA442_RS05895 (QA442_05895) comX 1140734..1140898 (+) 165 WP_014665191.1 competence pheromone ComX -
  QA442_RS05900 (QA442_05900) comP 1140910..1143210 (+) 2301 WP_251198651.1 histidine kinase Regulator
  QA442_RS05905 (QA442_05905) comA 1143291..1143935 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QA442_RS05910 (QA442_05910) - 1143954..1144334 (+) 381 WP_040081970.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=814886 QA442_RS05885 WP_003220708.1 1139537..1139677(+) (degQ) [Bacillus stercoris strain Mal05]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=814886 QA442_RS05885 WP_003220708.1 1139537..1139677(+) (degQ) [Bacillus stercoris strain Mal05]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATCGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1