Detailed information NTG0080994

Bioinformatically predicted

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: HT085_RS08290
• Genome accession: NZ_AP023069
• Coordinates: 1580566..1581015 (-)
• Length: 149 a.a.
• NCBI ID: WP_002214937.1
• Uniprot ID: A0AA44U8B7
• Organism: Neisseria gonorrhoeae strain TUM19854
• Function: DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1574011..1588295	1580566..1581015	within	0

Gene organization within MGE regions

Location: 1574011..1588295

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HT085_RS08240	-	1574011..1574289 (-)	279	WP_003691583.1	hypothetical protein	-
HT085_RS08245 (TUM19854C_15870)	-	1574296..1574514 (-)	219	WP_003691584.1	major capsid protein	-
HT085_RS08250 (TUM19854C_15880)	-	1574588..1574785 (-)	198	WP_003689600.1	hypothetical protein	-
HT085_RS08255 (TUM19854C_15890)	-	1574790..1575080 (-)	291	WP_012503914.1	hypothetical protein	-
HT085_RS08260 (TUM19854C_15900)	-	1575125..1576474 (-)	1350	WP_025455830.1	replication initiation factor domain-containing protein	-
HT085_RS08265 (TUM19854C_15910)	-	1576613..1577035 (-)	423	WP_003691751.1	very short patch repair endonuclease	-
HT085_RS11915 (TUM19854C_15920)	-	1577041..1577637 (-)	597	WP_012503916.1	TIGR02391 family protein	-
HT085_RS11920 (TUM19854C_15930)	-	1577827..1578684 (-)	858	WP_012503917.1	ATP-binding protein	-
HT085_RS08275 (TUM19854C_15940)	-	1578698..1579027 (-)	330	WP_002234365.1	DNA cytosine methyltransferase	-
HT085_RS08280	-	1579066..1579674 (-)	609	WP_080229275.1	DNA cytosine methyltransferase	-
HT085_RS08290 (TUM19854C_15950)	comP	1580566..1581015 (-)	450	WP_002214937.1	type IV pilin protein	Machinery gene
HT085_RS08295 (TUM19854C_15960)	comE	1581103..1581498 (-)	396	WP_003703428.1	helix-hairpin-helix domain-containing protein	Machinery gene
HT085_RS11925	-	1581600..1581719 (-)	120	Protein_1613	competence protein ComE	-
HT085_RS08325 (TUM19854C_15970)	-	1587344..1587997 (-)	654	Protein_1614	TIGR01621 family pseudouridine synthase	-
HT085_RS08330 (TUM19854C_15980)	-	1587951..1588295 (-)	345	WP_003691787.1	HAD hydrolase family protein	-

Sequence

Protein

• Length: 149 a.a.
• Molecular weight: 16834.81 Da
• Isoelectric Point: 9.7951

>NTDB_id=80994 HT085_RS08290 WP_002214937.1 1580566..1581015(-) (comP) [Neisseria gonorrhoeae strain TUM19854]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK

Nucleotide

• Length: 450 bp

>NTDB_id=80994 HT085_RS08290 WP_002214937.1 1580566..1581015(-) (comP) [Neisseria gonorrhoeae strain TUM19854]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG

Domains

Predicted by InterproScan.

• Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS) (28-107)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comP	Neisseria gonorrhoeae MS11	100	100	1
comP	Neisseria meningitidis 8013	99.329	100	0.993
comP	Neisseria subflava NJ9703	49.66	98.658	0.49