Detailed information
Overview
| Name | comGF | Type | Machinery gene |
| Locus tag | LLUC7005_RS10750 | Genome accession | NZ_CP120933 |
| Coordinates | 2146065..2146511 (-) | Length | 148 a.a. |
| NCBI ID | WP_029344525.1 | Uniprot ID | A0AAP4JUI5 |
| Organism | Lactococcus lactis subsp. lactis strain UC7005 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2145215..2190515 | 2146065..2146511 | within | 0 |
Gene organization within MGE regions
Location: 2145215..2190515
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC7005_RS10740 (LLUC7005_10710) | - | 2145215..2145652 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC7005_RS10745 (LLUC7005_10715) | comGG | 2145742..2146026 (-) | 285 | WP_003129993.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLUC7005_RS10750 (LLUC7005_10720) | comGF | 2146065..2146511 (-) | 447 | WP_029344525.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC7005_RS10755 (LLUC7005_10725) | comGE | 2146474..2146770 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC7005_RS10760 (LLUC7005_10730) | comGD | 2146742..2147173 (-) | 432 | WP_014570794.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LLUC7005_RS10765 (LLUC7005_10735) | comGC | 2147133..2147402 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLUC7005_RS10770 (LLUC7005_10740) | - | 2147549..2148073 (-) | 525 | WP_014570795.1 | GNAT family N-acetyltransferase | - |
| LLUC7005_RS10775 (LLUC7005_10745) | - | 2148152..2148931 (-) | 780 | WP_014570796.1 | peptidoglycan amidohydrolase family protein | - |
| LLUC7005_RS10780 (LLUC7005_10750) | - | 2148931..2149230 (-) | 300 | WP_014570797.1 | phage holin | - |
| LLUC7005_RS10785 (LLUC7005_10755) | - | 2149243..2149593 (-) | 351 | WP_014570798.1 | hypothetical protein | - |
| LLUC7005_RS10790 (LLUC7005_10760) | - | 2149606..2149842 (-) | 237 | WP_014570799.1 | hypothetical protein | - |
| LLUC7005_RS10795 (LLUC7005_10765) | - | 2149854..2153939 (-) | 4086 | WP_193363677.1 | hypothetical protein | - |
| LLUC7005_RS10800 (LLUC7005_10770) | - | 2153918..2155447 (-) | 1530 | WP_014570562.1 | distal tail protein Dit | - |
| LLUC7005_RS10805 (LLUC7005_10775) | - | 2155457..2157670 (-) | 2214 | WP_014570561.1 | phage tail tape measure protein | - |
| LLUC7005_RS10810 (LLUC7005_10780) | - | 2157660..2158367 (-) | 708 | WP_014570560.1 | Gp15 family bacteriophage protein | - |
| LLUC7005_RS10815 (LLUC7005_10785) | - | 2158383..2158790 (-) | 408 | WP_003131323.1 | hypothetical protein | - |
| LLUC7005_RS10820 (LLUC7005_10790) | - | 2158847..2159323 (-) | 477 | WP_014570559.1 | phage tail tube protein | - |
| LLUC7005_RS10825 (LLUC7005_10795) | - | 2159334..2159768 (-) | 435 | WP_014570558.1 | minor capsid protein | - |
| LLUC7005_RS10830 (LLUC7005_10800) | - | 2159768..2160097 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| LLUC7005_RS10835 (LLUC7005_10805) | - | 2160094..2160438 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| LLUC7005_RS10840 (LLUC7005_10810) | - | 2160428..2160829 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| LLUC7005_RS10845 (LLUC7005_10815) | - | 2160903..2161139 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| LLUC7005_RS10850 (LLUC7005_10820) | - | 2161168..2162085 (-) | 918 | WP_003131315.1 | hypothetical protein | - |
| LLUC7005_RS10855 (LLUC7005_10825) | - | 2162100..2163164 (-) | 1065 | WP_124156149.1 | XkdF-like putative serine protease domain-containing protein | - |
| LLUC7005_RS10860 (LLUC7005_10830) | - | 2163180..2164010 (-) | 831 | WP_014570553.1 | phage minor head protein | - |
| LLUC7005_RS10865 (LLUC7005_10835) | - | 2164003..2165532 (-) | 1530 | WP_014570552.1 | phage portal protein | - |
| LLUC7005_RS10870 (LLUC7005_10840) | terL | 2165545..2166996 (-) | 1452 | WP_014570551.1 | phage terminase large subunit | - |
| LLUC7005_RS10875 (LLUC7005_10845) | - | 2166977..2167474 (-) | 498 | WP_014570801.1 | hypothetical protein | - |
| LLUC7005_RS10880 (LLUC7005_10850) | - | 2167503..2168660 (-) | 1158 | Protein_2116 | DNA modification methylase | - |
| LLUC7005_RS10890 (LLUC7005_10860) | - | 2169137..2169559 (-) | 423 | WP_014570802.1 | RinA family protein | - |
| LLUC7005_RS10895 (LLUC7005_10865) | - | 2169637..2169798 (-) | 162 | WP_003131301.1 | hypothetical protein | - |
| LLUC7005_RS10900 (LLUC7005_10870) | - | 2169927..2170121 (-) | 195 | WP_023349206.1 | DUF1660 domain-containing protein | - |
| LLUC7005_RS10905 (LLUC7005_10875) | - | 2170118..2170336 (-) | 219 | WP_014570803.1 | hypothetical protein | - |
| LLUC7005_RS10910 (LLUC7005_10880) | - | 2170397..2170720 (-) | 324 | WP_014570804.1 | DUF1140 family protein | - |
| LLUC7005_RS10915 (LLUC7005_10885) | - | 2170723..2171094 (-) | 372 | WP_014570805.1 | hypothetical protein | - |
| LLUC7005_RS10920 (LLUC7005_10890) | - | 2171087..2171221 (-) | 135 | WP_257795509.1 | hypothetical protein | - |
| LLUC7005_RS10925 (LLUC7005_10895) | - | 2171271..2171522 (-) | 252 | WP_014570807.1 | hypothetical protein | - |
| LLUC7005_RS10930 (LLUC7005_10900) | - | 2171519..2171863 (-) | 345 | WP_198493811.1 | hypothetical protein | - |
| LLUC7005_RS10935 (LLUC7005_10905) | - | 2171867..2172286 (-) | 420 | WP_003129863.1 | dUTP diphosphatase | - |
| LLUC7005_RS10940 (LLUC7005_10910) | - | 2172283..2172957 (-) | 675 | WP_014570539.1 | DUF1642 domain-containing protein | - |
| LLUC7005_RS10945 (LLUC7005_10915) | - | 2173099..2173488 (-) | 390 | WP_014570537.1 | hypothetical protein | - |
| LLUC7005_RS10950 (LLUC7005_10920) | - | 2173500..2173775 (-) | 276 | WP_014570536.1 | hypothetical protein | - |
| LLUC7005_RS10955 (LLUC7005_10925) | - | 2174098..2174508 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| LLUC7005_RS10960 (LLUC7005_10930) | - | 2174521..2174763 (-) | 243 | WP_014570811.1 | L-rhamnose isomerase | - |
| LLUC7005_RS10965 (LLUC7005_10935) | - | 2174756..2175670 (-) | 915 | WP_014570812.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LLUC7005_RS10970 (LLUC7005_10940) | - | 2175934..2176860 (-) | 927 | WP_014570813.1 | RecT family recombinase | - |
| LLUC7005_RS10975 (LLUC7005_10945) | - | 2176857..2177690 (-) | 834 | WP_014570814.1 | hypothetical protein | - |
| LLUC7005_RS10980 (LLUC7005_10950) | - | 2177793..2178041 (-) | 249 | WP_014570815.1 | hypothetical protein | - |
| LLUC7005_RS10985 (LLUC7005_10955) | - | 2178055..2178177 (-) | 123 | WP_014570816.1 | hypothetical protein | - |
| LLUC7005_RS10990 (LLUC7005_10960) | - | 2178174..2178356 (-) | 183 | WP_043991177.1 | hypothetical protein | - |
| LLUC7005_RS10995 (LLUC7005_10965) | - | 2178372..2179061 (-) | 690 | WP_014570818.1 | phage regulatory protein | - |
| LLUC7005_RS11000 (LLUC7005_10970) | - | 2179120..2179353 (-) | 234 | WP_014570819.1 | helix-turn-helix transcriptional regulator | - |
| LLUC7005_RS11005 (LLUC7005_10975) | - | 2179530..2179940 (+) | 411 | WP_014570820.1 | helix-turn-helix domain-containing protein | - |
| LLUC7005_RS11010 (LLUC7005_10980) | - | 2179951..2180535 (+) | 585 | WP_014570821.1 | hypothetical protein | - |
| LLUC7005_RS11015 (LLUC7005_10985) | - | 2180591..2181130 (+) | 540 | WP_014570822.1 | PH domain-containing protein | - |
| LLUC7005_RS11020 (LLUC7005_10990) | - | 2181256..2182713 (+) | 1458 | WP_014570823.1 | recombinase family protein | - |
| LLUC7005_RS11025 (LLUC7005_10995) | - | 2182710..2182850 (-) | 141 | WP_228777719.1 | hypothetical protein | - |
| LLUC7005_RS11030 (LLUC7005_11000) | comGB | 2182864..2183937 (-) | 1074 | WP_014570824.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLUC7005_RS11035 (LLUC7005_11005) | comGA | 2183831..2184770 (-) | 940 | Protein_2146 | competence type IV pilus ATPase ComGA | - |
| LLUC7005_RS11040 (LLUC7005_11010) | - | 2184890..2189806 (-) | 4917 | WP_014570825.1 | PolC-type DNA polymerase III | - |
| LLUC7005_RS11045 (LLUC7005_11015) | - | 2189979..2190515 (-) | 537 | WP_003130594.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 17111.91 Da Isoelectric Point: 8.6780
>NTDB_id=809450 LLUC7005_RS10750 WP_029344525.1 2146065..2146511(-) (comGF) [Lactococcus lactis subsp. lactis strain UC7005]
MERKLCDLNFKVKAFTLLECLVALLAISGSVLVISGLTKMLKEQVAISQSDSIKDWQIFCQQMRFELSGTKLDRVEQNFL
YVTKDKKLRFGFMSDDFRKTDDKGQGYQPMLYDIKAAKIQATKNLITIRIDFNQGGERTFIYQFPEDT
MERKLCDLNFKVKAFTLLECLVALLAISGSVLVISGLTKMLKEQVAISQSDSIKDWQIFCQQMRFELSGTKLDRVEQNFL
YVTKDKKLRFGFMSDDFRKTDDKGQGYQPMLYDIKAAKIQATKNLITIRIDFNQGGERTFIYQFPEDT
Nucleotide
Download Length: 447 bp
>NTDB_id=809450 LLUC7005_RS10750 WP_029344525.1 2146065..2146511(-) (comGF) [Lactococcus lactis subsp. lactis strain UC7005]
ATGGAAAGGAAATTATGCGACTTGAACTTCAAAGTTAAAGCATTTACCTTGTTGGAGTGTTTGGTGGCACTTCTTGCAAT
TTCTGGTTCAGTCCTTGTCATCTCAGGTTTAACAAAGATGTTGAAAGAACAAGTGGCGATTAGTCAAAGTGATAGCATAA
AAGATTGGCAAATTTTCTGTCAGCAAATGCGTTTTGAACTCTCAGGAACAAAATTAGATAGGGTAGAACAGAATTTTCTG
TATGTAACTAAAGATAAAAAACTAAGGTTTGGTTTTATGAGTGATGATTTCCGGAAGACTGATGACAAAGGTCAGGGTTA
TCAGCCAATGCTTTATGATATAAAAGCGGCTAAGATTCAAGCTACTAAAAATTTAATAACCATAAGAATTGATTTTAATC
AAGGAGGTGAAAGAACATTTATTTATCAATTTCCAGAAGATACGTAA
ATGGAAAGGAAATTATGCGACTTGAACTTCAAAGTTAAAGCATTTACCTTGTTGGAGTGTTTGGTGGCACTTCTTGCAAT
TTCTGGTTCAGTCCTTGTCATCTCAGGTTTAACAAAGATGTTGAAAGAACAAGTGGCGATTAGTCAAAGTGATAGCATAA
AAGATTGGCAAATTTTCTGTCAGCAAATGCGTTTTGAACTCTCAGGAACAAAATTAGATAGGGTAGAACAGAATTTTCTG
TATGTAACTAAAGATAAAAAACTAAGGTTTGGTTTTATGAGTGATGATTTCCGGAAGACTGATGACAAAGGTCAGGGTTA
TCAGCCAATGCTTTATGATATAAAAGCGGCTAAGATTCAAGCTACTAAAAATTTAATAACCATAAGAATTGATTTTAATC
AAGGAGGTGAAAGAACATTTATTTATCAATTTCCAGAAGATACGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGF | Lactococcus lactis subsp. cremoris KW2 |
76.259 |
93.919 |
0.716 |
| comYF | Streptococcus mutans UA140 |
48.227 |
95.27 |
0.459 |
| comYF | Streptococcus mutans UA159 |
47.518 |
95.27 |
0.453 |
| comGF/cglF | Streptococcus mitis SK321 |
43.066 |
92.568 |
0.399 |
| comGF/cglF | Streptococcus pneumoniae Rx1 |
40.426 |
95.27 |
0.385 |
| comGF/cglF | Streptococcus pneumoniae D39 |
40.426 |
95.27 |
0.385 |
| comGF/cglF | Streptococcus pneumoniae R6 |
40.426 |
95.27 |
0.385 |
| comGF/cglF | Streptococcus pneumoniae TIGR4 |
40.426 |
95.27 |
0.385 |
| comGF/cglF | Streptococcus mitis NCTC 12261 |
41.606 |
92.568 |
0.385 |