Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | HT079_RS05875 | Genome accession | NZ_AP023067 |
| Coordinates | 1138861..1139334 (-) | Length | 157 a.a. |
| NCBI ID | WP_172760509.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain TUM19853 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1088990..1149139 | 1138861..1139334 | within | 0 |
Gene organization within MGE regions
Location: 1088990..1149139
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HT079_RS05520 (TUM19853C_10610) | - | 1088990..1089643 (-) | 654 | WP_172763129.1 | IS1595 family transposase | - |
| HT079_RS05530 (TUM19853C_10630) | purM | 1090641..1091675 (-) | 1035 | WP_003698590.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| HT079_RS05540 | - | 1092364..1093353 (+) | 990 | WP_003689040.1 | site-specific integrase | - |
| HT079_RS05545 (TUM19853C_10660) | - | 1093695..1094174 (+) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| HT079_RS05550 (TUM19853C_10670) | - | 1094234..1097278 (-) | 3045 | WP_172760435.1 | tape measure protein | - |
| HT079_RS05555 | - | 1097308..1097457 (-) | 150 | WP_003691402.1 | hypothetical protein | - |
| HT079_RS05560 (TUM19853C_10680) | - | 1097769..1097942 (-) | 174 | WP_003705498.1 | hypothetical protein | - |
| HT079_RS05565 (TUM19853C_10690) | - | 1097926..1098270 (-) | 345 | WP_003695464.1 | hypothetical protein | - |
| HT079_RS05570 (TUM19853C_10700) | - | 1098271..1098810 (-) | 540 | WP_050163081.1 | TIGR02594 family protein | - |
| HT079_RS12235 | - | 1098852..1098977 (-) | 126 | WP_255294325.1 | hypothetical protein | - |
| HT079_RS05575 (TUM19853C_10710) | - | 1099017..1099253 (+) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| HT079_RS05580 (TUM19853C_10720) | - | 1099253..1099600 (+) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| HT079_RS05585 (TUM19853C_10730) | - | 1099608..1099841 (+) | 234 | WP_003692884.1 | hypothetical protein | - |
| HT079_RS05590 (TUM19853C_10740) | - | 1099971..1100303 (-) | 333 | WP_003691408.1 | hypothetical protein | - |
| HT079_RS05595 (TUM19853C_10750) | - | 1100304..1100774 (-) | 471 | WP_003691410.1 | hypothetical protein | - |
| HT079_RS05600 (TUM19853C_10760) | - | 1100845..1101150 (-) | 306 | WP_003689058.1 | hypothetical protein | - |
| HT079_RS05605 (TUM19853C_10770) | - | 1101262..1105407 (-) | 4146 | WP_148048749.1 | phage tail protein | - |
| HT079_RS05610 (TUM19853C_10780) | - | 1105647..1105925 (+) | 279 | WP_003689062.1 | XRE family transcriptional regulator | - |
| HT079_RS05615 (TUM19853C_10790) | - | 1105953..1106384 (-) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| HT079_RS05620 (TUM19853C_10800) | - | 1106386..1107240 (-) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| HT079_RS05625 (TUM19853C_10810) | - | 1107237..1107836 (-) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| HT079_RS05630 (TUM19853C_10820) | - | 1107836..1108102 (-) | 267 | WP_003689070.1 | hypothetical protein | - |
| HT079_RS05635 (TUM19853C_10830) | - | 1108114..1108443 (-) | 330 | WP_003692871.1 | hypothetical protein | - |
| HT079_RS05640 (TUM19853C_10840) | - | 1108504..1109274 (-) | 771 | WP_172760436.1 | hypothetical protein | - |
| HT079_RS05645 (TUM19853C_10850) | - | 1109300..1109728 (-) | 429 | WP_003689076.1 | hypothetical protein | - |
| HT079_RS05650 (TUM19853C_10860) | - | 1109725..1110207 (-) | 483 | WP_044271038.1 | HK97 gp10 family phage protein | - |
| HT079_RS05655 (TUM19853C_10870) | - | 1110207..1110737 (-) | 531 | WP_003689080.1 | head-tail connector protein | - |
| HT079_RS05660 (TUM19853C_10880) | - | 1110740..1111111 (-) | 372 | WP_148048747.1 | hypothetical protein | - |
| HT079_RS05665 (TUM19853C_10890) | - | 1111118..1112617 (-) | 1500 | WP_003691419.1 | hypothetical protein | - |
| HT079_RS05670 (TUM19853C_10900) | - | 1112659..1113816 (-) | 1158 | WP_010360058.1 | HK97 family phage prohead protease | - |
| HT079_RS05675 (TUM19853C_10910) | - | 1113884..1116031 (-) | 2148 | WP_003691423.1 | phage portal protein | - |
| HT079_RS05680 (TUM19853C_10920) | terL | 1116028..1117449 (-) | 1422 | WP_003689090.1 | phage terminase large subunit | - |
| HT079_RS05685 (TUM19853C_10930) | - | 1117511..1117960 (-) | 450 | WP_003695485.1 | hypothetical protein | - |
| HT079_RS05690 (TUM19853C_10940) | - | 1118253..1119176 (-) | 924 | WP_249931467.1 | type I restriction endonuclease | - |
| HT079_RS05695 (TUM19853C_10950) | - | 1119267..1119674 (-) | 408 | WP_003691430.1 | hypothetical protein | - |
| HT079_RS05700 (TUM19853C_10960) | - | 1119941..1120321 (-) | 381 | WP_017147222.1 | RusA family crossover junction endodeoxyribonuclease | - |
| HT079_RS12050 (TUM19853C_10970) | - | 1120312..1120593 (-) | 282 | WP_003689109.1 | hypothetical protein | - |
| HT079_RS05705 (TUM19853C_10980) | - | 1120621..1120770 (-) | 150 | WP_003689110.1 | hypothetical protein | - |
| HT079_RS05710 (TUM19853C_10990) | - | 1120947..1121441 (-) | 495 | WP_041421248.1 | DUF3310 domain-containing protein | - |
| HT079_RS05715 (TUM19853C_11000) | - | 1121455..1121685 (-) | 231 | WP_172762856.1 | hypothetical protein | - |
| HT079_RS05720 (TUM19853C_11010) | - | 1121755..1122537 (-) | 783 | WP_025456432.1 | ATP-binding protein | - |
| HT079_RS05725 (TUM19853C_11020) | - | 1122552..1123568 (-) | 1017 | WP_172760570.1 | helix-turn-helix domain-containing protein | - |
| HT079_RS05730 (TUM19853C_11030) | - | 1123565..1123792 (-) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| HT079_RS05735 (TUM19853C_11040) | - | 1123965..1124153 (+) | 189 | WP_003698903.1 | hypothetical protein | - |
| HT079_RS05740 (TUM19853C_11050) | - | 1124130..1124285 (-) | 156 | WP_003691446.1 | hypothetical protein | - |
| HT079_RS05745 (TUM19853C_11060) | - | 1124365..1124580 (-) | 216 | WP_223169978.1 | helix-turn-helix transcriptional regulator | - |
| HT079_RS05750 (TUM19853C_11070) | - | 1124708..1125412 (+) | 705 | WP_003702453.1 | helix-turn-helix transcriptional regulator | - |
| HT079_RS05755 (TUM19853C_11080) | - | 1125572..1126111 (+) | 540 | WP_003695998.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| HT079_RS05760 (TUM19853C_11090) | - | 1126112..1126471 (+) | 360 | WP_003691733.1 | hypothetical protein | - |
| HT079_RS05765 (TUM19853C_11100) | - | 1126488..1126706 (-) | 219 | WP_003691731.1 | hypothetical protein | - |
| HT079_RS05770 (TUM19853C_11110) | - | 1127190..1127390 (+) | 201 | WP_003692842.1 | hypothetical protein | - |
| HT079_RS05775 (TUM19853C_11120) | - | 1127423..1127899 (+) | 477 | WP_012504141.1 | hypothetical protein | - |
| HT079_RS05780 (TUM19853C_11130) | - | 1127896..1128183 (+) | 288 | WP_172763651.1 | hypothetical protein | - |
| HT079_RS05785 (TUM19853C_11140) | - | 1128324..1128656 (+) | 333 | WP_003687946.1 | hypothetical protein | - |
| HT079_RS05790 (TUM19853C_11150) | - | 1128809..1129087 (+) | 279 | WP_003691529.1 | NGO1622 family putative holin | - |
| HT079_RS05795 (TUM19853C_11160) | - | 1129084..1129245 (+) | 162 | WP_003693867.1 | hypothetical protein | - |
| HT079_RS05800 (TUM19853C_11170) | - | 1129314..1130000 (+) | 687 | WP_012503754.1 | phage replication initiation protein, NGO0469 family | - |
| HT079_RS05805 (TUM19853C_11180) | - | 1130140..1130322 (+) | 183 | WP_003691535.1 | hypothetical protein | - |
| HT079_RS05810 (TUM19853C_11190) | - | 1130319..1130810 (+) | 492 | WP_004464807.1 | siphovirus Gp157 family protein | - |
| HT079_RS05815 (TUM19853C_11200) | - | 1130862..1131077 (+) | 216 | WP_003691538.1 | hypothetical protein | - |
| HT079_RS12395 | - | 1131188..1131421 (+) | 234 | Protein_1121 | hypothetical protein | - |
| HT079_RS05825 (TUM19853C_11220) | - | 1131735..1132418 (+) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| HT079_RS05830 (TUM19853C_11240) | - | 1132613..1132882 (+) | 270 | WP_003687928.1 | hypothetical protein | - |
| HT079_RS05835 (TUM19853C_11250) | - | 1133238..1134434 (-) | 1197 | WP_172760508.1 | integrase arm-type DNA-binding domain-containing protein | - |
| HT079_RS05850 (TUM19853C_11260) | yaaA | 1134965..1135744 (-) | 780 | WP_003694987.1 | peroxide stress protein YaaA | - |
| HT079_RS05855 (TUM19853C_11280) | dapC | 1135900..1137087 (-) | 1188 | WP_033910019.1 | succinyldiaminopimelate transaminase | - |
| HT079_RS05860 (TUM19853C_11290) | dut | 1137159..1137611 (-) | 453 | WP_172760504.1 | dUTP diphosphatase | - |
| HT079_RS05865 (TUM19853C_11300) | - | 1137777..1138486 (+) | 710 | Protein_1128 | AzlC family ABC transporter permease | - |
| HT079_RS05870 (TUM19853C_11310) | - | 1138483..1138791 (+) | 309 | WP_123771557.1 | AzlD family protein | - |
| HT079_RS05875 (TUM19853C_11320) | pilL | 1138861..1139334 (-) | 474 | WP_172760509.1 | PilX family type IV pilin | Machinery gene |
| HT079_RS05880 (TUM19853C_11330) | pilK | 1139336..1139947 (-) | 612 | WP_123771562.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| HT079_RS05885 (TUM19853C_11340) | pilJ | 1139926..1140894 (-) | 969 | WP_172760505.1 | PilW family protein | Machinery gene |
| HT079_RS05890 (TUM19853C_11350) | pilI | 1140891..1141499 (-) | 609 | WP_172760506.1 | type IV pilus modification protein PilV | Machinery gene |
| HT079_RS05895 (TUM19853C_11360) | pilH | 1141531..1142196 (-) | 666 | WP_003701057.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| HT079_RS05900 (TUM19853C_11370) | dnaB | 1142453..1143856 (-) | 1404 | WP_012503477.1 | replicative DNA helicase | - |
| HT079_RS05905 (TUM19853C_11380) | - | 1144019..1144600 (+) | 582 | WP_172760507.1 | superoxide dismutase | - |
| HT079_RS05910 (TUM19853C_11390) | - | 1144830..1145339 (-) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| HT079_RS05915 (TUM19853C_11400) | - | 1145666..1145998 (-) | 333 | WP_003687908.1 | hypothetical protein | - |
| HT079_RS05920 (TUM19853C_11410) | cysT | 1146179..1147017 (+) | 839 | Protein_1139 | sulfate ABC transporter permease subunit CysT | - |
| HT079_RS05925 (TUM19853C_11420) | cysW | 1147206..1148066 (+) | 861 | WP_172760483.1 | sulfate ABC transporter permease subunit CysW | - |
| HT079_RS05930 (TUM19853C_11430) | - | 1148063..1149139 (+) | 1077 | WP_003687905.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17687.44 Da Isoelectric Point: 9.3988
>NTDB_id=80928 HT079_RS05875 WP_172760509.1 1138861..1139334(-) (pilL) [Neisseria gonorrhoeae strain TUM19853]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLEIFVSGYKM
NPKIAKKYNVSVRFVDKEKPRAYRLVGVPNEGTGYTLSVWMNSVGDGYKCRDATSAQAYLETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLEIFVSGYKM
NPKIAKKYNVSVRFVDKEKPRAYRLVGVPNEGTGYTLSVWMNSVGDGYKCRDATSAQAYLETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=80928 HT079_RS05875 WP_172760509.1 1138861..1139334(-) (pilL) [Neisseria gonorrhoeae strain TUM19853]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAATGTTTCGGTAAGGTTTGTCGATAAGGAAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGAGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGCCTATTTGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAATGTTTCGGTAAGGTTTGTCGATAAGGAAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGAGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGCCTATTTGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
96.178 |
100 |
0.962 |
| pilX | Neisseria meningitidis 8013 |
87.898 |
100 |
0.879 |