Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilH   Type   Machinery gene
Locus tag   HT079_RS05895 Genome accession   NZ_AP023067
Coordinates   1141531..1142196 (-) Length   221 a.a.
NCBI ID   WP_003701057.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain TUM19853     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1088990..1149139 1141531..1142196 within 0


Gene organization within MGE regions


Location: 1088990..1149139
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HT079_RS05520 (TUM19853C_10610) - 1088990..1089643 (-) 654 WP_172763129.1 IS1595 family transposase -
  HT079_RS05530 (TUM19853C_10630) purM 1090641..1091675 (-) 1035 WP_003698590.1 phosphoribosylformylglycinamidine cyclo-ligase -
  HT079_RS05540 - 1092364..1093353 (+) 990 WP_003689040.1 site-specific integrase -
  HT079_RS05545 (TUM19853C_10660) - 1093695..1094174 (+) 480 WP_002241413.1 DUF4760 domain-containing protein -
  HT079_RS05550 (TUM19853C_10670) - 1094234..1097278 (-) 3045 WP_172760435.1 tape measure protein -
  HT079_RS05555 - 1097308..1097457 (-) 150 WP_003691402.1 hypothetical protein -
  HT079_RS05560 (TUM19853C_10680) - 1097769..1097942 (-) 174 WP_003705498.1 hypothetical protein -
  HT079_RS05565 (TUM19853C_10690) - 1097926..1098270 (-) 345 WP_003695464.1 hypothetical protein -
  HT079_RS05570 (TUM19853C_10700) - 1098271..1098810 (-) 540 WP_050163081.1 TIGR02594 family protein -
  HT079_RS12235 - 1098852..1098977 (-) 126 WP_255294325.1 hypothetical protein -
  HT079_RS05575 (TUM19853C_10710) - 1099017..1099253 (+) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  HT079_RS05580 (TUM19853C_10720) - 1099253..1099600 (+) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  HT079_RS05585 (TUM19853C_10730) - 1099608..1099841 (+) 234 WP_003692884.1 hypothetical protein -
  HT079_RS05590 (TUM19853C_10740) - 1099971..1100303 (-) 333 WP_003691408.1 hypothetical protein -
  HT079_RS05595 (TUM19853C_10750) - 1100304..1100774 (-) 471 WP_003691410.1 hypothetical protein -
  HT079_RS05600 (TUM19853C_10760) - 1100845..1101150 (-) 306 WP_003689058.1 hypothetical protein -
  HT079_RS05605 (TUM19853C_10770) - 1101262..1105407 (-) 4146 WP_148048749.1 phage tail protein -
  HT079_RS05610 (TUM19853C_10780) - 1105647..1105925 (+) 279 WP_003689062.1 XRE family transcriptional regulator -
  HT079_RS05615 (TUM19853C_10790) - 1105953..1106384 (-) 432 WP_003689064.1 NlpC/P60 family protein -
  HT079_RS05620 (TUM19853C_10800) - 1106386..1107240 (-) 855 WP_003698614.1 DUF2163 domain-containing protein -
  HT079_RS05625 (TUM19853C_10810) - 1107237..1107836 (-) 600 WP_003692874.1 DUF2460 domain-containing protein -
  HT079_RS05630 (TUM19853C_10820) - 1107836..1108102 (-) 267 WP_003689070.1 hypothetical protein -
  HT079_RS05635 (TUM19853C_10830) - 1108114..1108443 (-) 330 WP_003692871.1 hypothetical protein -
  HT079_RS05640 (TUM19853C_10840) - 1108504..1109274 (-) 771 WP_172760436.1 hypothetical protein -
  HT079_RS05645 (TUM19853C_10850) - 1109300..1109728 (-) 429 WP_003689076.1 hypothetical protein -
  HT079_RS05650 (TUM19853C_10860) - 1109725..1110207 (-) 483 WP_044271038.1 HK97 gp10 family phage protein -
  HT079_RS05655 (TUM19853C_10870) - 1110207..1110737 (-) 531 WP_003689080.1 head-tail connector protein -
  HT079_RS05660 (TUM19853C_10880) - 1110740..1111111 (-) 372 WP_148048747.1 hypothetical protein -
  HT079_RS05665 (TUM19853C_10890) - 1111118..1112617 (-) 1500 WP_003691419.1 hypothetical protein -
  HT079_RS05670 (TUM19853C_10900) - 1112659..1113816 (-) 1158 WP_010360058.1 HK97 family phage prohead protease -
  HT079_RS05675 (TUM19853C_10910) - 1113884..1116031 (-) 2148 WP_003691423.1 phage portal protein -
  HT079_RS05680 (TUM19853C_10920) terL 1116028..1117449 (-) 1422 WP_003689090.1 phage terminase large subunit -
  HT079_RS05685 (TUM19853C_10930) - 1117511..1117960 (-) 450 WP_003695485.1 hypothetical protein -
  HT079_RS05690 (TUM19853C_10940) - 1118253..1119176 (-) 924 WP_249931467.1 type I restriction endonuclease -
  HT079_RS05695 (TUM19853C_10950) - 1119267..1119674 (-) 408 WP_003691430.1 hypothetical protein -
  HT079_RS05700 (TUM19853C_10960) - 1119941..1120321 (-) 381 WP_017147222.1 RusA family crossover junction endodeoxyribonuclease -
  HT079_RS12050 (TUM19853C_10970) - 1120312..1120593 (-) 282 WP_003689109.1 hypothetical protein -
  HT079_RS05705 (TUM19853C_10980) - 1120621..1120770 (-) 150 WP_003689110.1 hypothetical protein -
  HT079_RS05710 (TUM19853C_10990) - 1120947..1121441 (-) 495 WP_041421248.1 DUF3310 domain-containing protein -
  HT079_RS05715 (TUM19853C_11000) - 1121455..1121685 (-) 231 WP_172762856.1 hypothetical protein -
  HT079_RS05720 (TUM19853C_11010) - 1121755..1122537 (-) 783 WP_025456432.1 ATP-binding protein -
  HT079_RS05725 (TUM19853C_11020) - 1122552..1123568 (-) 1017 WP_172760570.1 helix-turn-helix domain-containing protein -
  HT079_RS05730 (TUM19853C_11030) - 1123565..1123792 (-) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  HT079_RS05735 (TUM19853C_11040) - 1123965..1124153 (+) 189 WP_003698903.1 hypothetical protein -
  HT079_RS05740 (TUM19853C_11050) - 1124130..1124285 (-) 156 WP_003691446.1 hypothetical protein -
  HT079_RS05745 (TUM19853C_11060) - 1124365..1124580 (-) 216 WP_223169978.1 helix-turn-helix transcriptional regulator -
  HT079_RS05750 (TUM19853C_11070) - 1124708..1125412 (+) 705 WP_003702453.1 helix-turn-helix transcriptional regulator -
  HT079_RS05755 (TUM19853C_11080) - 1125572..1126111 (+) 540 WP_003695998.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  HT079_RS05760 (TUM19853C_11090) - 1126112..1126471 (+) 360 WP_003691733.1 hypothetical protein -
  HT079_RS05765 (TUM19853C_11100) - 1126488..1126706 (-) 219 WP_003691731.1 hypothetical protein -
  HT079_RS05770 (TUM19853C_11110) - 1127190..1127390 (+) 201 WP_003692842.1 hypothetical protein -
  HT079_RS05775 (TUM19853C_11120) - 1127423..1127899 (+) 477 WP_012504141.1 hypothetical protein -
  HT079_RS05780 (TUM19853C_11130) - 1127896..1128183 (+) 288 WP_172763651.1 hypothetical protein -
  HT079_RS05785 (TUM19853C_11140) - 1128324..1128656 (+) 333 WP_003687946.1 hypothetical protein -
  HT079_RS05790 (TUM19853C_11150) - 1128809..1129087 (+) 279 WP_003691529.1 NGO1622 family putative holin -
  HT079_RS05795 (TUM19853C_11160) - 1129084..1129245 (+) 162 WP_003693867.1 hypothetical protein -
  HT079_RS05800 (TUM19853C_11170) - 1129314..1130000 (+) 687 WP_012503754.1 phage replication initiation protein, NGO0469 family -
  HT079_RS05805 (TUM19853C_11180) - 1130140..1130322 (+) 183 WP_003691535.1 hypothetical protein -
  HT079_RS05810 (TUM19853C_11190) - 1130319..1130810 (+) 492 WP_004464807.1 siphovirus Gp157 family protein -
  HT079_RS05815 (TUM19853C_11200) - 1130862..1131077 (+) 216 WP_003691538.1 hypothetical protein -
  HT079_RS12395 - 1131188..1131421 (+) 234 Protein_1121 hypothetical protein -
  HT079_RS05825 (TUM19853C_11220) - 1131735..1132418 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  HT079_RS05830 (TUM19853C_11240) - 1132613..1132882 (+) 270 WP_003687928.1 hypothetical protein -
  HT079_RS05835 (TUM19853C_11250) - 1133238..1134434 (-) 1197 WP_172760508.1 integrase arm-type DNA-binding domain-containing protein -
  HT079_RS05850 (TUM19853C_11260) yaaA 1134965..1135744 (-) 780 WP_003694987.1 peroxide stress protein YaaA -
  HT079_RS05855 (TUM19853C_11280) dapC 1135900..1137087 (-) 1188 WP_033910019.1 succinyldiaminopimelate transaminase -
  HT079_RS05860 (TUM19853C_11290) dut 1137159..1137611 (-) 453 WP_172760504.1 dUTP diphosphatase -
  HT079_RS05865 (TUM19853C_11300) - 1137777..1138486 (+) 710 Protein_1128 AzlC family ABC transporter permease -
  HT079_RS05870 (TUM19853C_11310) - 1138483..1138791 (+) 309 WP_123771557.1 AzlD family protein -
  HT079_RS05875 (TUM19853C_11320) pilL 1138861..1139334 (-) 474 WP_172760509.1 PilX family type IV pilin Machinery gene
  HT079_RS05880 (TUM19853C_11330) pilK 1139336..1139947 (-) 612 WP_123771562.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  HT079_RS05885 (TUM19853C_11340) pilJ 1139926..1140894 (-) 969 WP_172760505.1 PilW family protein Machinery gene
  HT079_RS05890 (TUM19853C_11350) pilI 1140891..1141499 (-) 609 WP_172760506.1 type IV pilus modification protein PilV Machinery gene
  HT079_RS05895 (TUM19853C_11360) pilH 1141531..1142196 (-) 666 WP_003701057.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  HT079_RS05900 (TUM19853C_11370) dnaB 1142453..1143856 (-) 1404 WP_012503477.1 replicative DNA helicase -
  HT079_RS05905 (TUM19853C_11380) - 1144019..1144600 (+) 582 WP_172760507.1 superoxide dismutase -
  HT079_RS05910 (TUM19853C_11390) - 1144830..1145339 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  HT079_RS05915 (TUM19853C_11400) - 1145666..1145998 (-) 333 WP_003687908.1 hypothetical protein -
  HT079_RS05920 (TUM19853C_11410) cysT 1146179..1147017 (+) 839 Protein_1139 sulfate ABC transporter permease subunit CysT -
  HT079_RS05925 (TUM19853C_11420) cysW 1147206..1148066 (+) 861 WP_172760483.1 sulfate ABC transporter permease subunit CysW -
  HT079_RS05930 (TUM19853C_11430) - 1148063..1149139 (+) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 221 a.a.        Molecular weight: 24658.11 Da        Isoelectric Point: 9.1564

>NTDB_id=80932 HT079_RS05895 WP_003701057.1 1141531..1142196(-) (pilH) [Neisseria gonorrhoeae strain TUM19853]
MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHAEQVANLLRFSRGEAVRLNLPVYICPTQVKKDGTGN
NQCDLGKKEQGMLAFGDKNDNKAYDGDAADVFLRSVVLNDDIKDKRIDYTFNHIAFGQTRPTADRVVWTFNQNGTFGYLP
DQNLKNNSKFVYSDGYIQIVLTDARAVSDADRKFRSAVVLIDSSGRVEVCRKNDTRAVCKH

Nucleotide


Download         Length: 666 bp        

>NTDB_id=80932 HT079_RS05895 WP_003701057.1 1141531..1142196(-) (pilH) [Neisseria gonorrhoeae strain TUM19853]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGCCATTGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGGTTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTACCCAAGTTAAAAAAGACGGTACGGGCAAC
AACCAATGCGACCTCGGTAAGAAGGAACAGGGGATGTTGGCTTTCGGCGACAAAAACGACAATAAGGCATATGACGGCGA
TGCTGCGGATGTTTTTCTCCGCAGCGTGGTATTGAATGATGATATCAAGGATAAGCGGATTGATTACACTTTCAATCATA
TCGCTTTCGGTCAAACACGGCCGACTGCCGACCGTGTTGTTTGGACTTTTAACCAAAACGGGACATTCGGCTATTTGCCC
GATCAGAATCTCAAGAATAATTCCAAATTTGTTTATTCTGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGT
TTCAGATGCCGATAGGAAATTCCGTTCGGCGGTGGTTTTGATTGACAGCAGCGGCAGGGTCGAAGTTTGTCGTAAAAACG
ATACGCGCGCCGTATGCAAACATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilH Neisseria gonorrhoeae MS11

89.14

100

0.891


Multiple sequence alignment