Detailed information    

insolico Bioinformatically predicted

Overview

Name   comP   Type   Machinery gene
Locus tag   HT079_RS02160 Genome accession   NZ_AP023067
Coordinates   443351..443800 (+) Length   149 a.a.
NCBI ID   WP_002214937.1    Uniprot ID   A0AA44U8B7
Organism   Neisseria gonorrhoeae strain TUM19853     
Function   DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 436368..490369 443351..443800 within 0


Gene organization within MGE regions


Location: 436368..490369
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HT079_RS02125 (TUM19853C_04030) - 436368..437021 (+) 654 Protein_397 TIGR01621 family pseudouridine synthase -
  HT079_RS11830 - 442647..442766 (+) 120 Protein_398 competence protein ComE -
  HT079_RS02155 (TUM19853C_04040) comE 442868..443263 (+) 396 WP_003703428.1 helix-hairpin-helix domain-containing protein Machinery gene
  HT079_RS02160 (TUM19853C_04050) comP 443351..443800 (+) 450 WP_002214937.1 type IV pilin protein Machinery gene
  HT079_RS02170 - 444177..444323 (-) 147 WP_003691757.1 hypothetical protein -
  HT079_RS02175 - 444710..445300 (+) 591 WP_080229150.1 DNA cytosine methyltransferase -
  HT079_RS02180 (TUM19853C_04060) - 445339..445668 (+) 330 WP_002234365.1 DNA cytosine methyltransferase -
  HT079_RS11835 (TUM19853C_04070) - 445682..446539 (+) 858 WP_012503917.1 ATP-binding protein -
  HT079_RS11840 (TUM19853C_04080) - 446729..447325 (+) 597 WP_012503916.1 TIGR02391 family protein -
  HT079_RS02190 (TUM19853C_04090) - 447331..447753 (+) 423 WP_003691751.1 very short patch repair endonuclease -
  HT079_RS02195 (TUM19853C_04100) - 447892..449237 (+) 1346 Protein_407 replication initiation factor domain-containing protein -
  HT079_RS02200 (TUM19853C_04110) - 449282..449572 (+) 291 WP_012503914.1 hypothetical protein -
  HT079_RS02205 (TUM19853C_04120) - 449577..449774 (+) 198 WP_003689600.1 hypothetical protein -
  HT079_RS02210 (TUM19853C_04130) - 449848..450066 (+) 219 WP_003691584.1 major capsid protein -
  HT079_RS02215 - 450073..450351 (+) 279 WP_003691583.1 hypothetical protein -
  HT079_RS02220 (TUM19853C_04140) - 450479..450796 (+) 318 WP_003689167.1 DUF1132 family protein -
  HT079_RS02225 - 450738..452291 (+) 1554 Protein_413 IgG-binding virulence factor TspB family protein -
  HT079_RS02230 (TUM19853C_04150) - 452305..452595 (+) 291 WP_017147034.1 DUF2523 domain-containing protein -
  HT079_RS02235 (TUM19853C_04160) - 452605..453690 (+) 1086 WP_003698930.1 zonular occludens toxin domain-containing protein -
  HT079_RS02240 (TUM19853C_04170) - 453811..454170 (+) 360 WP_003689732.1 hypothetical protein -
  HT079_RS02245 (TUM19853C_04180) - 454802..455764 (-) 963 WP_172763125.1 IS110 family transposase -
  HT079_RS02250 - 455767..455949 (-) 183 Protein_418 glycosyltransferase -
  HT079_RS02255 (TUM19853C_04190) ribA 456117..456710 (-) 594 WP_003689161.1 GTP cyclohydrolase II -
  HT079_RS02260 (TUM19853C_04200) - 456703..457377 (-) 675 WP_172760565.1 hypothetical protein -
  HT079_RS02270 (TUM19853C_04210) - 457668..457862 (-) 195 WP_003689159.1 AlpA family transcriptional regulator -
  HT079_RS11845 (TUM19853C_04220) - 457888..458100 (-) 213 WP_003698676.1 hypothetical protein -
  HT079_RS11850 - 458072..458302 (-) 231 WP_003695893.1 hypothetical protein -
  HT079_RS02280 (TUM19853C_04230) - 458299..459282 (-) 984 WP_050170976.1 hypothetical protein -
  HT079_RS02285 (TUM19853C_04240) - 459393..459608 (-) 216 WP_003691538.1 hypothetical protein -
  HT079_RS02290 (TUM19853C_04250) - 459660..460151 (-) 492 WP_004464807.1 siphovirus Gp157 family protein -
  HT079_RS02295 (TUM19853C_04260) - 460148..460330 (-) 183 WP_003691535.1 hypothetical protein -
  HT079_RS02300 (TUM19853C_04270) - 460470..461156 (-) 687 WP_012503754.1 phage replication initiation protein, NGO0469 family -
  HT079_RS02305 (TUM19853C_04280) - 461225..461386 (-) 162 WP_003693867.1 hypothetical protein -
  HT079_RS02310 (TUM19853C_04290) - 461383..461661 (-) 279 WP_003691529.1 NGO1622 family putative holin -
  HT079_RS02315 (TUM19853C_04300) - 461814..462146 (-) 333 WP_003687946.1 hypothetical protein -
  HT079_RS02320 (TUM19853C_04310) - 462287..462574 (-) 288 WP_050155496.1 hypothetical protein -
  HT079_RS02325 (TUM19853C_04320) - 462571..463047 (-) 477 WP_012504141.1 hypothetical protein -
  HT079_RS02330 (TUM19853C_04330) - 463080..463280 (-) 201 WP_003692842.1 hypothetical protein -
  HT079_RS02335 (TUM19853C_04340) - 463478..463891 (-) 414 WP_003687963.1 hypothetical protein -
  HT079_RS02340 (TUM19853C_04350) - 463888..464349 (-) 462 WP_003687965.1 helix-turn-helix transcriptional regulator -
  HT079_RS02345 (TUM19853C_04360) - 464366..464803 (-) 438 WP_003687967.1 hypothetical protein -
  HT079_RS02350 (TUM19853C_04370) - 464918..465634 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  HT079_RS02355 (TUM19853C_04380) - 465703..465939 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  HT079_RS02360 (TUM19853C_04390) - 466019..466174 (+) 156 WP_003689578.1 hypothetical protein -
  HT079_RS02365 (TUM19853C_04400) - 466151..466339 (-) 189 WP_003691445.1 hypothetical protein -
  HT079_RS02370 (TUM19853C_04410) - 466512..466739 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  HT079_RS11855 (TUM19853C_04430) - 466857..467324 (+) 468 WP_229692802.1 hypothetical protein -
  HT079_RS11860 (TUM19853C_04440) - 467419..467922 (+) 504 WP_010360005.1 hypothetical protein -
  HT079_RS02380 (TUM19853C_04450) - 467919..469280 (+) 1362 WP_172760560.1 DnaB-like helicase C-terminal domain-containing protein -
  HT079_RS02385 (TUM19853C_04460) - 469297..469548 (+) 252 WP_172761191.1 hypothetical protein -
  HT079_RS02390 (TUM19853C_04470) - 469562..470056 (+) 495 WP_172760575.1 DUF3310 domain-containing protein -
  HT079_RS02395 (TUM19853C_04480) - 470370..470519 (+) 150 WP_010360014.1 hypothetical protein -
  HT079_RS11865 (TUM19853C_04490) - 470548..470829 (+) 282 WP_003689109.1 hypothetical protein -
  HT079_RS02400 (TUM19853C_04500) - 470820..471257 (+) 438 WP_106278737.1 RusA family crossover junction endodeoxyribonuclease -
  HT079_RS02405 (TUM19853C_04510) - 471250..471555 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  HT079_RS02410 (TUM19853C_04520) - 471552..471935 (+) 384 WP_003690918.1 recombination protein NinB -
  HT079_RS02415 (TUM19853C_04530) - 471926..472444 (+) 519 WP_172760533.1 HNH endonuclease signature motif containing protein -
  HT079_RS02420 (TUM19853C_04540) - 472509..472931 (+) 423 WP_003690919.1 hypothetical protein -
  HT079_RS11870 (TUM19853C_04550) - 472931..473470 (+) 540 WP_003690920.1 hypothetical protein -
  HT079_RS02435 (TUM19853C_04560) - 473451..474725 (+) 1275 WP_047919159.1 PBSX family phage terminase large subunit -
  HT079_RS02440 (TUM19853C_04570) - 474710..476977 (+) 2268 WP_225577699.1 hypothetical protein -
  HT079_RS02445 (TUM19853C_04580) - 477215..478411 (+) 1197 WP_003693452.1 hypothetical protein -
  HT079_RS02450 (TUM19853C_04590) - 478408..485715 (+) 7308 WP_172762838.1 PLxRFG domain-containing protein -
  HT079_RS02460 (TUM19853C_04610) - 486341..487636 (+) 1296 WP_003693441.1 DUF4043 family protein -
  HT079_RS02465 (TUM19853C_04620) - 487695..488168 (+) 474 WP_113852114.1 hypothetical protein -
  HT079_RS02470 (TUM19853C_04630) - 488174..488659 (+) 486 WP_003693438.1 hypothetical protein -
  HT079_RS02475 (TUM19853C_04640) - 488656..489309 (+) 654 WP_227719074.1 hypothetical protein -
  HT079_RS02480 (TUM19853C_04650) - 489332..489481 (+) 150 WP_017146863.1 hypothetical protein -
  HT079_RS02485 (TUM19853C_04660) - 489518..490369 (-) 852 WP_003693432.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 149 a.a.        Molecular weight: 16834.81 Da        Isoelectric Point: 9.7951

>NTDB_id=80918 HT079_RS02160 WP_002214937.1 443351..443800(+) (comP) [Neisseria gonorrhoeae strain TUM19853]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK

Nucleotide


Download         Length: 450 bp        

>NTDB_id=80918 HT079_RS02160 WP_002214937.1 443351..443800(+) (comP) [Neisseria gonorrhoeae strain TUM19853]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG

Domains

Predicted by InterproScan.

Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS)

(28-107)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comP Neisseria gonorrhoeae MS11

100

100

1
  comP Neisseria meningitidis 8013

99.329

100

0.993
  comP Neisseria subflava NJ9703

49.66

98.658

0.49

Multiple sequence alignment