Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | P4829_RS16195 | Genome accession | NZ_CP120846 |
| Coordinates | 3197657..3197800 (-) | Length | 47 a.a. |
| NCBI ID | WP_003327149.1 | Uniprot ID | - |
| Organism | Bacillus atrophaeus strain MBLB1156 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3192657..3202800
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4829_RS16170 (P4829_16170) | - | 3192941..3193321 (-) | 381 | WP_010789785.1 | hotdog fold thioesterase | - |
| P4829_RS16175 (P4829_16175) | comA | 3193339..3193980 (-) | 642 | WP_003327154.1 | response regulator transcription factor | Regulator |
| P4829_RS16180 (P4829_16180) | comP | 3194061..3196370 (-) | 2310 | WP_063637893.1 | histidine kinase | Regulator |
| P4829_RS16185 (P4829_16185) | comX | 3196386..3196607 (-) | 222 | WP_063637894.1 | competence pheromone ComX | - |
| P4829_RS16190 (P4829_16190) | - | 3196604..3197473 (-) | 870 | WP_063638377.1 | polyprenyl synthetase family protein | - |
| P4829_RS16195 (P4829_16195) | degQ | 3197657..3197800 (-) | 144 | WP_003327149.1 | degradation enzyme regulation protein DegQ | Regulator |
| P4829_RS16200 (P4829_16200) | - | 3198260..3198619 (+) | 360 | WP_063637895.1 | hypothetical protein | - |
| P4829_RS16205 (P4829_16205) | - | 3198638..3199870 (-) | 1233 | WP_003327147.1 | EAL and HDOD domain-containing protein | - |
| P4829_RS16210 (P4829_16210) | - | 3200008..3201474 (-) | 1467 | WP_155729092.1 | nicotinate phosphoribosyltransferase | - |
| P4829_RS16215 (P4829_16215) | - | 3201490..3202041 (-) | 552 | WP_063637896.1 | isochorismatase family cysteine hydrolase | - |
| P4829_RS16220 (P4829_16220) | - | 3202149..3202547 (-) | 399 | WP_063637897.1 | YueI family protein | - |
Sequence
Protein
Download Length: 47 a.a. Molecular weight: 5645.61 Da Isoelectric Point: 8.5787
>NTDB_id=808872 P4829_RS16195 WP_003327149.1 3197657..3197800(-) (degQ) [Bacillus atrophaeus strain MBLB1156]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
Nucleotide
Download Length: 144 bp
>NTDB_id=808872 P4829_RS16195 WP_003327149.1 3197657..3197800(-) (degQ) [Bacillus atrophaeus strain MBLB1156]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
95.455 |
93.617 |
0.894 |