Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | P3T49_RS16190 | Genome accession | NZ_CP120723 |
| Coordinates | 3196435..3196578 (-) | Length | 47 a.a. |
| NCBI ID | WP_003327149.1 | Uniprot ID | - |
| Organism | Bacillus atrophaeus strain NX-12 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3191435..3201578
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3T49_RS16165 | - | 3191786..3192166 (-) | 381 | WP_199679676.1 | hotdog fold thioesterase | - |
| P3T49_RS16170 | comA | 3192184..3192825 (-) | 642 | WP_003327154.1 | response regulator transcription factor | Regulator |
| P3T49_RS16175 | comP | 3192906..3195203 (-) | 2298 | WP_277713830.1 | histidine kinase | Regulator |
| P3T49_RS16180 | comX | 3195214..3195378 (-) | 165 | WP_106046982.1 | competence pheromone ComX | - |
| P3T49_RS16185 | - | 3195391..3196251 (-) | 861 | WP_216412504.1 | polyprenyl synthetase family protein | - |
| P3T49_RS16190 | degQ | 3196435..3196578 (-) | 144 | WP_003327149.1 | degradation enzyme regulation protein DegQ | Regulator |
| P3T49_RS16195 | - | 3197038..3197397 (+) | 360 | WP_063637895.1 | hypothetical protein | - |
| P3T49_RS16200 | - | 3197416..3198648 (-) | 1233 | WP_003327147.1 | EAL and HDOD domain-containing protein | - |
| P3T49_RS16205 | - | 3198786..3200252 (-) | 1467 | WP_106046983.1 | nicotinate phosphoribosyltransferase | - |
| P3T49_RS16210 | - | 3200268..3200819 (-) | 552 | WP_063637896.1 | cysteine hydrolase family protein | - |
| P3T49_RS16215 | - | 3200927..3201325 (-) | 399 | WP_003327144.1 | YueI family protein | - |
Sequence
Protein
Download Length: 47 a.a. Molecular weight: 5645.61 Da Isoelectric Point: 8.5787
>NTDB_id=808388 P3T49_RS16190 WP_003327149.1 3196435..3196578(-) (degQ) [Bacillus atrophaeus strain NX-12]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
Nucleotide
Download Length: 144 bp
>NTDB_id=808388 P3T49_RS16190 WP_003327149.1 3196435..3196578(-) (degQ) [Bacillus atrophaeus strain NX-12]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
95.455 |
93.617 |
0.894 |