Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P0M29_RS04045 Genome accession   NZ_CP120711
Coordinates   854742..854915 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain 12Y     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 849742..859915
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P0M29_RS04030 (P0M29_04030) gcvT 850555..851655 (-) 1101 WP_029973877.1 glycine cleavage system aminomethyltransferase GcvT -
  P0M29_RS04035 (P0M29_04035) - 852079..853749 (+) 1671 WP_021494309.1 SNF2-related protein -
  P0M29_RS04040 (P0M29_04040) - 853771..854565 (+) 795 WP_014418368.1 YqhG family protein -
  P0M29_RS04045 (P0M29_04045) sinI 854742..854915 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  P0M29_RS04050 (P0M29_04050) sinR 854949..855284 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P0M29_RS04055 (P0M29_04055) - 855332..856117 (-) 786 WP_007408329.1 TasA family protein -
  P0M29_RS04060 (P0M29_04060) - 856182..856766 (-) 585 WP_012117977.1 signal peptidase I -
  P0M29_RS04065 (P0M29_04065) tapA 856738..857409 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  P0M29_RS04070 (P0M29_04070) - 857668..857997 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  P0M29_RS04075 (P0M29_04075) - 858038..858217 (-) 180 WP_003153093.1 YqzE family protein -
  P0M29_RS04080 (P0M29_04080) comGG 858274..858651 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  P0M29_RS04085 (P0M29_04085) comGF 858652..859116 (-) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  P0M29_RS04090 (P0M29_04090) comGE 859061..859375 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  P0M29_RS04095 (P0M29_04095) comGD 859359..859796 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=808150 P0M29_RS04045 WP_014418369.1 854742..854915(+) (sinI) [Bacillus velezensis strain 12Y]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=808150 P0M29_RS04045 WP_014418369.1 854742..854915(+) (sinI) [Bacillus velezensis strain 12Y]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719