Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   P0M29_RS04090 Genome accession   NZ_CP120711
Coordinates   859061..859375 (-) Length   104 a.a.
NCBI ID   WP_029973875.1    Uniprot ID   -
Organism   Bacillus velezensis strain 12Y     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 854061..864375
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P0M29_RS04045 (P0M29_04045) sinI 854742..854915 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  P0M29_RS04050 (P0M29_04050) sinR 854949..855284 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P0M29_RS04055 (P0M29_04055) - 855332..856117 (-) 786 WP_007408329.1 TasA family protein -
  P0M29_RS04060 (P0M29_04060) - 856182..856766 (-) 585 WP_012117977.1 signal peptidase I -
  P0M29_RS04065 (P0M29_04065) tapA 856738..857409 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  P0M29_RS04070 (P0M29_04070) - 857668..857997 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  P0M29_RS04075 (P0M29_04075) - 858038..858217 (-) 180 WP_003153093.1 YqzE family protein -
  P0M29_RS04080 (P0M29_04080) comGG 858274..858651 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  P0M29_RS04085 (P0M29_04085) comGF 858652..859116 (-) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  P0M29_RS04090 (P0M29_04090) comGE 859061..859375 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  P0M29_RS04095 (P0M29_04095) comGD 859359..859796 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  P0M29_RS04100 (P0M29_04100) comGC 859786..860052 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  P0M29_RS04105 (P0M29_04105) comGB 860099..861136 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  P0M29_RS04110 (P0M29_04110) comGA 861123..862193 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  P0M29_RS04115 (P0M29_04115) - 862386..863336 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11862.88 Da        Isoelectric Point: 6.9470

>NTDB_id=808153 P0M29_RS04090 WP_029973875.1 859061..859375(-) (comGE) [Bacillus velezensis strain 12Y]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=808153 P0M29_RS04090 WP_029973875.1 859061..859375(-) (comGE) [Bacillus velezensis strain 12Y]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49