Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   P6S76_RS14415 Genome accession   NZ_CP120641
Coordinates   2989150..2989290 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain YL2021     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2984150..2994290
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P6S76_RS14390 - 2984445..2984828 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  P6S76_RS14395 comA 2984850..2985494 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  P6S76_RS14400 - 2985575..2987885 (-) 2311 Protein_2771 histidine kinase -
  P6S76_RS14405 comX 2987905..2988081 (-) 177 WP_007408675.1 competence pheromone ComX -
  P6S76_RS14410 comQ 2988081..2989019 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  P6S76_RS14415 degQ 2989150..2989290 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  P6S76_RS14420 - 2989756..2990097 (+) 342 WP_007408677.1 hypothetical protein -
  P6S76_RS14425 - 2990104..2991327 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  P6S76_RS14430 - 2991457..2992923 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  P6S76_RS14435 - 2992941..2993492 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  P6S76_RS14440 - 2993589..2993987 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=807432 P6S76_RS14415 WP_003152043.1 2989150..2989290(-) (degQ) [Bacillus velezensis strain YL2021]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=807432 P6S76_RS14415 WP_003152043.1 2989150..2989290(-) (degQ) [Bacillus velezensis strain YL2021]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891