Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   P5623_RS19700 Genome accession   NZ_CP120625
Coordinates   3695656..3695796 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain DSM 103869     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3690656..3700796
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5623_RS19675 (P5623_19675) - 3690888..3691295 (+) 408 WP_056702629.1 YueI family protein -
  P5623_RS19680 (P5623_19680) - 3691356..3691907 (+) 552 WP_046526549.1 isochorismatase family cysteine hydrolase -
  P5623_RS19685 (P5623_19685) - 3691925..3693394 (+) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  P5623_RS19690 (P5623_19690) - 3693534..3694760 (+) 1227 WP_008345870.1 HDOD domain-containing protein -
  P5623_RS19695 (P5623_19695) - 3694797..3695150 (-) 354 WP_019744042.1 hypothetical protein -
  P5623_RS19700 (P5623_19700) degQ 3695656..3695796 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  P5623_RS19705 (P5623_19705) - 3695948..3696871 (+) 924 WP_046526551.1 polyprenyl synthetase family protein -
  P5623_RS19710 (P5623_19710) comX 3696849..3697019 (+) 171 WP_017358941.1 competence pheromone ComX -
  P5623_RS19715 (P5623_19715) comP 3697033..3699339 (+) 2307 WP_017367961.1 ATP-binding protein Regulator
  P5623_RS19720 (P5623_19720) comA 3699420..3700061 (+) 642 WP_007500477.1 response regulator transcription factor Regulator
  P5623_RS19725 (P5623_19725) - 3700085..3700474 (+) 390 WP_017367960.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=807232 P5623_RS19700 WP_003213123.1 3695656..3695796(+) (degQ) [Bacillus altitudinis strain DSM 103869]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=807232 P5623_RS19700 WP_003213123.1 3695656..3695796(+) (degQ) [Bacillus altitudinis strain DSM 103869]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696