Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   P5647_RS16445 Genome accession   NZ_CP120622
Coordinates   3151810..3151950 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DSM 1090     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3146810..3156950
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5647_RS16420 (P5647_16420) yuxO 3147124..3147504 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  P5647_RS16425 (P5647_16425) comA 3147523..3148167 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P5647_RS16430 (P5647_16430) comP 3148248..3150556 (-) 2309 Protein_3179 two-component system sensor histidine kinase ComP -
  P5647_RS16435 (P5647_16435) comX 3150571..3150738 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  P5647_RS16440 (P5647_16440) comQ 3150726..3151625 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  P5647_RS16445 (P5647_16445) degQ 3151810..3151950 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5647_RS16450 (P5647_16450) - 3152172..3152297 (+) 126 WP_003228793.1 hypothetical protein -
  P5647_RS16455 (P5647_16455) - 3152411..3152779 (+) 369 WP_003243784.1 hypothetical protein -
  P5647_RS16460 (P5647_16460) pdeH 3152755..3153984 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  P5647_RS16465 (P5647_16465) pncB 3154121..3155593 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  P5647_RS16470 (P5647_16470) pncA 3155609..3156160 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  P5647_RS16475 (P5647_16475) yueI 3156257..3156655 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=807158 P5647_RS16445 WP_003220708.1 3151810..3151950(-) (degQ) [Bacillus subtilis strain DSM 1090]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=807158 P5647_RS16445 WP_003220708.1 3151810..3151950(-) (degQ) [Bacillus subtilis strain DSM 1090]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1