Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   P5647_RS16435 Genome accession   NZ_CP120622
Coordinates   3150571..3150738 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain DSM 1090     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3145571..3155738
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5647_RS16405 (P5647_16405) mrpE 3145967..3146443 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  P5647_RS16410 (P5647_16410) mrpF 3146443..3146727 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  P5647_RS16415 (P5647_16415) mnhG 3146711..3147085 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  P5647_RS16420 (P5647_16420) yuxO 3147124..3147504 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  P5647_RS16425 (P5647_16425) comA 3147523..3148167 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P5647_RS16430 (P5647_16430) comP 3148248..3150556 (-) 2309 Protein_3179 two-component system sensor histidine kinase ComP -
  P5647_RS16435 (P5647_16435) comX 3150571..3150738 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  P5647_RS16440 (P5647_16440) comQ 3150726..3151625 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  P5647_RS16445 (P5647_16445) degQ 3151810..3151950 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5647_RS16450 (P5647_16450) - 3152172..3152297 (+) 126 WP_003228793.1 hypothetical protein -
  P5647_RS16455 (P5647_16455) - 3152411..3152779 (+) 369 WP_003243784.1 hypothetical protein -
  P5647_RS16460 (P5647_16460) pdeH 3152755..3153984 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  P5647_RS16465 (P5647_16465) pncB 3154121..3155593 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=807156 P5647_RS16435 WP_003242801.1 3150571..3150738(-) (comX) [Bacillus subtilis strain DSM 1090]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=807156 P5647_RS16435 WP_003242801.1 3150571..3150738(-) (comX) [Bacillus subtilis strain DSM 1090]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1