Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   P5657_RS08190 Genome accession   NZ_CP120621
Coordinates   1593206..1593346 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DSM 13019     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1588206..1598346
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5657_RS08160 (P5657_08160) yueI 1588500..1588898 (+) 399 WP_015251331.1 YueI family protein -
  P5657_RS08165 (P5657_08165) pncA 1588995..1589546 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  P5657_RS08170 (P5657_08170) pncB 1589562..1591034 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  P5657_RS08175 (P5657_08175) pdeH 1591171..1592400 (+) 1230 WP_277710388.1 cyclic di-GMP phosphodiesterase -
  P5657_RS08180 (P5657_08180) - 1592376..1592744 (-) 369 WP_038828672.1 hypothetical protein -
  P5657_RS08185 (P5657_08185) - 1592859..1592984 (-) 126 WP_120028613.1 hypothetical protein -
  P5657_RS08190 (P5657_08190) degQ 1593206..1593346 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5657_RS08195 (P5657_08195) - 1593531..1594391 (+) 861 WP_032677058.1 polyprenyl synthetase family protein -
  P5657_RS08200 (P5657_08200) comX 1594406..1594567 (+) 162 WP_049140565.1 competence pheromone ComX -
  P5657_RS08205 (P5657_08205) comP 1594575..1596872 (+) 2298 WP_212082410.1 histidine kinase Regulator
  P5657_RS08210 (P5657_08210) comA 1596953..1597597 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P5657_RS08215 (P5657_08215) yuxO 1597616..1597996 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=807039 P5657_RS08190 WP_003220708.1 1593206..1593346(+) (degQ) [Bacillus subtilis strain DSM 13019]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=807039 P5657_RS08190 WP_003220708.1 1593206..1593346(+) (degQ) [Bacillus subtilis strain DSM 13019]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1