Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P5653_RS13645 Genome accession   NZ_CP120610
Coordinates   2703713..2703889 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain DSM 28591     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2698713..2708889
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5653_RS13630 (P5653_13630) gcvT 2699353..2700447 (-) 1095 WP_035338369.1 glycine cleavage system aminomethyltransferase GcvT -
  P5653_RS13635 (P5653_13635) - 2701042..2702721 (+) 1680 WP_020452163.1 SNF2-related protein -
  P5653_RS13640 (P5653_13640) - 2702728..2703522 (+) 795 WP_020452164.1 YqhG family protein -
  P5653_RS13645 (P5653_13645) sinI 2703713..2703889 (+) 177 WP_023855184.1 anti-repressor SinI Regulator
  P5653_RS13650 (P5653_13650) sinR 2703923..2704258 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  P5653_RS13655 (P5653_13655) - 2704363..2705157 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  P5653_RS13660 (P5653_13660) - 2705230..2705814 (-) 585 WP_035338370.1 signal peptidase I SipW -
  P5653_RS13665 (P5653_13665) tapA 2705811..2706539 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  P5653_RS13670 (P5653_13670) - 2706817..2707137 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  P5653_RS13675 (P5653_13675) - 2707167..2707349 (-) 183 WP_020452171.1 YqzE family protein -
  P5653_RS13680 (P5653_13680) comGG 2707438..2707803 (-) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  P5653_RS13685 (P5653_13685) comGF 2707815..2708297 (-) 483 WP_230588654.1 competence type IV pilus minor pilin ComGF -
  P5653_RS13690 (P5653_13690) comGE 2708212..2708559 (-) 348 WP_025811161.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=806833 P5653_RS13645 WP_023855184.1 2703713..2703889(+) (sinI) [Bacillus paralicheniformis strain DSM 28591]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=806833 P5653_RS13645 WP_023855184.1 2703713..2703889(+) (sinI) [Bacillus paralicheniformis strain DSM 28591]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5