Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   P5638_RS07405 Genome accession   NZ_CP120599
Coordinates   1491598..1491738 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain PRO114     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1486598..1496738
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5638_RS07380 (P5638_07380) - 1486827..1487234 (+) 408 WP_224426593.1 YueI family protein -
  P5638_RS07385 (P5638_07385) - 1487295..1487846 (+) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  P5638_RS07390 (P5638_07390) - 1487864..1489336 (+) 1473 WP_024425948.1 nicotinate phosphoribosyltransferase -
  P5638_RS07395 (P5638_07395) - 1489474..1490700 (+) 1227 WP_024425947.1 HDOD domain-containing protein -
  P5638_RS07400 (P5638_07400) - 1490736..1491092 (-) 357 WP_277722845.1 inner spore coat protein -
  P5638_RS07405 (P5638_07405) degQ 1491598..1491738 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  P5638_RS07410 (P5638_07410) - 1491890..1492813 (+) 924 WP_277722846.1 polyprenyl synthetase family protein -
  P5638_RS07415 (P5638_07415) comX 1492791..1492964 (+) 174 WP_060698182.1 competence pheromone ComX -
  P5638_RS07420 (P5638_07420) comP 1492978..1495269 (+) 2292 WP_224426590.1 ATP-binding protein Regulator
  P5638_RS07425 (P5638_07425) comA 1495350..1495991 (+) 642 WP_024423322.1 response regulator transcription factor Regulator
  P5638_RS07430 (P5638_07430) - 1496015..1496404 (+) 390 WP_024423321.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=806499 P5638_RS07405 WP_003213123.1 1491598..1491738(+) (degQ) [Bacillus safensis strain PRO114]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=806499 P5638_RS07405 WP_003213123.1 1491598..1491738(+) (degQ) [Bacillus safensis strain PRO114]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696