Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   P3T85_RS09110 Genome accession   NZ_CP120140
Coordinates   1797372..1797866 (-) Length   164 a.a.
NCBI ID   WP_323708748.1    Uniprot ID   -
Organism   Mammaliicoccus sciuri strain Dog035_2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1765310..1813211 1797372..1797866 within 0


Gene organization within MGE regions


Location: 1765310..1813211
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3T85_RS08860 (P3T85_08860) - 1765310..1766734 (-) 1425 WP_323708708.1 SH3 domain-containing protein -
  P3T85_RS08865 (P3T85_08865) - 1766783..1767031 (-) 249 WP_323708709.1 phage holin -
  P3T85_RS08870 (P3T85_08870) - 1767048..1767467 (-) 420 WP_323708710.1 hypothetical protein -
  P3T85_RS08875 (P3T85_08875) - 1767452..1767880 (-) 429 WP_323708711.1 hypothetical protein -
  P3T85_RS08880 (P3T85_08880) - 1767927..1768067 (-) 141 WP_323708712.1 XkdX family protein -
  P3T85_RS08885 (P3T85_08885) - 1768051..1768404 (-) 354 WP_323708713.1 hypothetical protein -
  P3T85_RS08890 (P3T85_08890) - 1768410..1769882 (-) 1473 WP_323708714.1 BppU family phage baseplate upper protein -
  P3T85_RS08895 (P3T85_08895) - 1769890..1771836 (-) 1947 WP_323708715.1 hypothetical protein -
  P3T85_RS08900 (P3T85_08900) - 1771836..1772120 (-) 285 WP_239760842.1 hypothetical protein -
  P3T85_RS08905 (P3T85_08905) - 1772113..1773672 (-) 1560 WP_323708716.1 prophage endopeptidase tail family protein -
  P3T85_RS08910 (P3T85_08910) - 1773681..1774529 (-) 849 WP_323708717.1 phage tail domain-containing protein -
  P3T85_RS08915 (P3T85_08915) - 1774530..1778891 (-) 4362 WP_323708718.1 tape measure protein -
  P3T85_RS08920 (P3T85_08920) - 1778925..1779242 (-) 318 WP_204207324.1 hypothetical protein -
  P3T85_RS08925 (P3T85_08925) - 1779263..1779853 (-) 591 WP_204207322.1 hypothetical protein -
  P3T85_RS08930 (P3T85_08930) - 1779935..1780534 (-) 600 WP_323708719.1 hypothetical protein -
  P3T85_RS08935 (P3T85_08935) - 1780572..1780982 (-) 411 WP_323708720.1 hypothetical protein -
  P3T85_RS08940 (P3T85_08940) - 1780983..1781468 (-) 486 WP_239760848.1 HK97 gp10 family phage protein -
  P3T85_RS08945 (P3T85_08945) - 1781469..1781807 (-) 339 WP_323708721.1 hypothetical protein -
  P3T85_RS08950 (P3T85_08950) - 1781804..1782157 (-) 354 WP_058612489.1 hypothetical protein -
  P3T85_RS08955 (P3T85_08955) - 1782168..1782350 (-) 183 WP_204168299.1 hypothetical protein -
  P3T85_RS08960 (P3T85_08960) - 1782387..1783424 (-) 1038 WP_323708722.1 major capsid protein -
  P3T85_RS08965 (P3T85_08965) - 1783457..1783828 (-) 372 WP_323708723.1 hypothetical protein -
  P3T85_RS08970 (P3T85_08970) - 1783832..1784440 (-) 609 WP_323708724.1 phage scaffolding protein -
  P3T85_RS08975 (P3T85_08975) - 1784651..1785697 (-) 1047 WP_323708725.1 phage minor capsid protein -
  P3T85_RS08980 (P3T85_08980) - 1785706..1787322 (-) 1617 WP_323708726.1 hypothetical protein -
  P3T85_RS08985 (P3T85_08985) - 1787340..1788620 (-) 1281 WP_323708727.1 PBSX family phage terminase large subunit -
  P3T85_RS08990 (P3T85_08990) - 1788617..1789048 (-) 432 WP_323708728.1 terminase small subunit -
  P3T85_RS08995 (P3T85_08995) - 1789181..1789366 (-) 186 WP_204170522.1 hypothetical protein -
  P3T85_RS09000 (P3T85_09000) - 1789418..1790041 (-) 624 WP_323708729.1 hypothetical protein -
  P3T85_RS09005 (P3T85_09005) - 1790312..1790752 (-) 441 WP_323708730.1 hypothetical protein -
  P3T85_RS09010 (P3T85_09010) - 1790779..1791273 (-) 495 WP_323708731.1 Holliday junction resolvase RecU -
  P3T85_RS09015 (P3T85_09015) - 1791575..1791775 (-) 201 WP_323708732.1 hypothetical protein -
  P3T85_RS09020 (P3T85_09020) - 1791845..1792039 (-) 195 WP_323708733.1 hypothetical protein -
  P3T85_RS09025 (P3T85_09025) - 1792036..1792236 (-) 201 WP_323708734.1 hypothetical protein -
  P3T85_RS09030 (P3T85_09030) - 1792239..1792427 (-) 189 WP_323708735.1 hypothetical protein -
  P3T85_RS09035 (P3T85_09035) - 1792424..1792666 (-) 243 WP_323708736.1 hypothetical protein -
  P3T85_RS09040 (P3T85_09040) - 1792670..1792822 (-) 153 WP_199193731.1 hypothetical protein -
  P3T85_RS09045 (P3T85_09045) - 1792826..1793179 (-) 354 WP_323708737.1 YopX family protein -
  P3T85_RS09050 (P3T85_09050) - 1793192..1793437 (-) 246 WP_323708738.1 hypothetical protein -
  P3T85_RS09055 (P3T85_09055) - 1793518..1793811 (-) 294 WP_323708928.1 MazG-like family protein -
  P3T85_RS09060 (P3T85_09060) - 1793969..1794190 (-) 222 WP_323708739.1 hypothetical protein -
  P3T85_RS09065 (P3T85_09065) - 1794192..1794362 (-) 171 WP_323708740.1 hypothetical protein -
  P3T85_RS09070 (P3T85_09070) - 1794364..1794600 (-) 237 WP_323708741.1 hypothetical protein -
  P3T85_RS09075 (P3T85_09075) - 1794778..1795002 (-) 225 WP_323708742.1 DUF3269 family protein -
  P3T85_RS09080 (P3T85_09080) - 1795007..1795525 (-) 519 WP_323708743.1 hypothetical protein -
  P3T85_RS09085 (P3T85_09085) - 1795576..1796172 (-) 597 WP_323708744.1 HNH endonuclease signature motif containing protein -
  P3T85_RS09090 (P3T85_09090) - 1796165..1796407 (-) 243 WP_037587674.1 hypothetical protein -
  P3T85_RS09095 (P3T85_09095) - 1796420..1796644 (-) 225 WP_323708745.1 hypothetical protein -
  P3T85_RS09100 (P3T85_09100) - 1796641..1797021 (-) 381 WP_323708746.1 hypothetical protein -
  P3T85_RS09105 (P3T85_09105) - 1797043..1797333 (-) 291 WP_323708747.1 hypothetical protein -
  P3T85_RS09110 (P3T85_09110) ssbA 1797372..1797866 (-) 495 WP_323708748.1 single-stranded DNA-binding protein Machinery gene
  P3T85_RS09115 (P3T85_09115) - 1797863..1798051 (-) 189 WP_204236990.1 hypothetical protein -
  P3T85_RS09120 (P3T85_09120) - 1798032..1798838 (-) 807 WP_119494083.1 ATP-binding protein -
  P3T85_RS09125 (P3T85_09125) - 1798840..1799715 (-) 876 WP_204236991.1 DnaD domain-containing protein -
  P3T85_RS09130 (P3T85_09130) - 1799731..1800444 (-) 714 WP_323708749.1 MBL fold metallo-hydrolase -
  P3T85_RS09135 (P3T85_09135) bet 1800434..1801213 (-) 780 WP_323708750.1 phage recombination protein Bet -
  P3T85_RS09140 (P3T85_09140) - 1801236..1803212 (-) 1977 WP_204236994.1 hypothetical protein -
  P3T85_RS09145 (P3T85_09145) - 1803286..1803570 (-) 285 WP_204236995.1 hypothetical protein -
  P3T85_RS09150 (P3T85_09150) - 1803584..1803757 (-) 174 WP_185805782.1 hypothetical protein -
  P3T85_RS09155 (P3T85_09155) - 1803768..1804271 (-) 504 WP_070373068.1 helix-turn-helix domain-containing protein -
  P3T85_RS09160 (P3T85_09160) - 1804467..1805183 (-) 717 WP_204236996.1 ORF6C domain-containing protein -
  P3T85_RS09165 (P3T85_09165) - 1805198..1805461 (-) 264 WP_058612456.1 hypothetical protein -
  P3T85_RS09170 (P3T85_09170) - 1805690..1805881 (-) 192 WP_204178263.1 helix-turn-helix transcriptional regulator -
  P3T85_RS09175 (P3T85_09175) - 1806048..1806419 (+) 372 WP_323708751.1 helix-turn-helix transcriptional regulator -
  P3T85_RS09180 (P3T85_09180) - 1806566..1807267 (+) 702 WP_204236998.1 PH domain-containing protein -
  P3T85_RS09185 (P3T85_09185) - 1807308..1807919 (+) 612 WP_204236999.1 hypothetical protein -
  P3T85_RS09190 (P3T85_09190) - 1807966..1808544 (+) 579 WP_204237000.1 DUF5067 domain-containing protein -
  P3T85_RS09195 (P3T85_09195) - 1808640..1809011 (+) 372 WP_204237001.1 hypothetical protein -
  P3T85_RS09200 (P3T85_09200) - 1809028..1809489 (+) 462 WP_058612451.1 ImmA/IrrE family metallo-endopeptidase -
  P3T85_RS09205 (P3T85_09205) - 1809501..1810703 (+) 1203 WP_323708752.1 site-specific integrase -
  P3T85_RS09210 (P3T85_09210) priA 1810803..1813211 (-) 2409 WP_204190352.1 primosomal protein N' -

Sequence

Protein


Download         Length: 164 a.a.        Molecular weight: 18582.22 Da        Isoelectric Point: 5.2564

>NTDB_id=803602 P3T85_RS09110 WP_323708748.1 1797372..1797866(-) (ssbA) [Mammaliicoccus sciuri strain Dog035_2]
MINRTVLVGRLVRDPEYRTTPSGVQVATFTLAVNRTFTNQQGEREADFINCVVFRKTAESVNQYLSKGKLAGVDGRLQSR
SYENNEGKKVFVTEVVCDNVQFLEPKDSQNNSNSYQNGTSYQKGNNYTQNNQNVQQGQNKAKYDQQNNPFNNGSDFDDTD
LPFD

Nucleotide


Download         Length: 495 bp        

>NTDB_id=803602 P3T85_RS09110 WP_323708748.1 1797372..1797866(-) (ssbA) [Mammaliicoccus sciuri strain Dog035_2]
ATGATTAATAGAACAGTATTAGTAGGGCGATTAGTACGTGATCCAGAATACCGAACTACACCGAGTGGCGTTCAAGTAGC
AACATTTACATTAGCAGTAAATCGTACTTTTACTAATCAACAAGGAGAACGTGAAGCAGATTTTATCAACTGTGTTGTAT
TTAGAAAAACAGCTGAGAGTGTAAATCAATATTTATCTAAAGGGAAATTAGCAGGCGTTGATGGAAGGTTACAAAGTAGA
AGTTATGAAAATAACGAAGGGAAAAAAGTATTTGTCACTGAAGTTGTTTGCGATAACGTTCAATTCCTAGAGCCTAAAGA
TAGTCAAAACAACTCAAATTCATATCAAAATGGAACGAGTTATCAAAAGGGTAACAACTATACCCAAAATAACCAAAACG
TCCAACAGGGGCAAAATAAAGCAAAATACGACCAACAAAATAATCCATTCAACAATGGCAGTGATTTTGATGATACAGAT
TTACCTTTTGACTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.814

100

0.585
  ssb Latilactobacillus sakei subsp. sakei 23K

50.286

100

0.537
  ssbB Bacillus subtilis subsp. subtilis str. 168

53.097

68.902

0.366