Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   P3U43_RS13745 Genome accession   NZ_CP120062
Coordinates   2789534..2790067 (-) Length   177 a.a.
NCBI ID   WP_320420745.1    Uniprot ID   -
Organism   Mammaliicoccus lentus strain Dog127_L     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2732838..2790185 2789534..2790067 within 0


Gene organization within MGE regions


Location: 2732838..2790185
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3U43_RS13445 (P3U43_13445) - 2733826..2734278 (+) 453 WP_016999240.1 GNAT family N-acetyltransferase -
  P3U43_RS13450 (P3U43_13450) - 2734286..2734600 (-) 315 WP_320420668.1 multidrug efflux SMR transporter -
  P3U43_RS13455 (P3U43_13455) - 2734602..2734925 (-) 324 WP_016999238.1 multidrug efflux SMR transporter -
  P3U43_RS13460 (P3U43_13460) - 2735204..2735545 (+) 342 WP_320420669.1 helix-turn-helix transcriptional regulator -
  P3U43_RS13465 (P3U43_13465) - 2735661..2736452 (-) 792 WP_135031824.1 DUF4097 family beta strand repeat-containing protein -
  P3U43_RS13470 (P3U43_13470) - 2736449..2737009 (-) 561 WP_016999235.1 HAAS signaling domain-containing protein -
  P3U43_RS13475 (P3U43_13475) - 2737002..2737325 (-) 324 WP_016999234.1 PadR family transcriptional regulator -
  P3U43_RS13480 (P3U43_13480) - 2737555..2737917 (-) 363 WP_135031826.1 hypothetical protein -
  P3U43_RS13485 (P3U43_13485) - 2737933..2738904 (-) 972 WP_135031828.1 VOC family protein -
  P3U43_RS13490 (P3U43_13490) - 2738941..2739522 (+) 582 WP_135031832.1 alpha/beta hydrolase -
  P3U43_RS13495 (P3U43_13495) - 2739542..2740789 (-) 1248 WP_064204276.1 MFS transporter -
  P3U43_RS13500 (P3U43_13500) - 2740789..2741364 (-) 576 WP_016999229.1 helix-turn-helix domain-containing protein -
  P3U43_RS13505 (P3U43_13505) - 2741606..2743219 (+) 1614 WP_135031836.1 BCCT family transporter -
  P3U43_RS13510 (P3U43_13510) - 2743352..2743885 (+) 534 WP_070044842.1 hypothetical protein -
  P3U43_RS13515 (P3U43_13515) - 2743954..2744592 (-) 639 WP_135031838.1 hypothetical protein -
  P3U43_RS13520 (P3U43_13520) - 2744934..2746160 (+) 1227 WP_064204280.1 hypothetical protein -
  P3U43_RS13525 (P3U43_13525) - 2746230..2746820 (-) 591 WP_016999224.1 type 1 glutamine amidotransferase family protein -
  P3U43_RS13530 (P3U43_13530) - 2747100..2748206 (+) 1107 WP_320420670.1 Gfo/Idh/MocA family oxidoreductase -
  P3U43_RS13535 (P3U43_13535) - 2748593..2748907 (+) 315 WP_000421280.1 YdcP family protein -
  P3U43_RS13540 (P3U43_13540) - 2748928..2749305 (+) 378 WP_001234189.1 YdcP family protein -
  P3U43_RS13545 (P3U43_13545) - 2749315..2750088 (+) 774 WP_000185760.1 hypothetical protein -
  P3U43_RS13550 (P3U43_13550) - 2750110..2751513 (+) 1404 WP_001130247.1 FtsK/SpoIIIE domain-containing protein -
  P3U43_RS13555 (P3U43_13555) mobT 2751695..2752879 (+) 1185 WP_000426691.1 MobT family relaxase -
  P3U43_RS13560 (P3U43_13560) - 2752876..2753148 (+) 273 WP_000055367.1 hypothetical protein -
  P3U43_RS13565 (P3U43_13565) - 2753145..2753366 (+) 222 WP_001009054.1 hypothetical protein -
  P3U43_RS13570 (P3U43_13570) - 2753408..2754187 (+) 780 WP_000678782.1 abortive infection family protein -
  P3U43_RS13575 (P3U43_13575) - 2754249..2754749 (+) 501 WP_000421245.1 antirestriction protein ArdA -
  P3U43_RS13580 (P3U43_13580) - 2754912..2756078 (+) 1167 WP_000195404.1 IS256 family transposase -
  P3U43_RS13585 (P3U43_13585) - 2756157..2757182 (+) 1026 WP_000234705.1 hypothetical protein -
  P3U43_RS13590 (P3U43_13590) - 2757253..2757648 (+) 396 WP_000723886.1 conjugal transfer protein -
  P3U43_RS13595 (P3U43_13595) - 2757632..2760085 (+) 2454 WP_000941001.1 ATP-binding protein -
  P3U43_RS13600 (P3U43_13600) - 2760082..2762109 (+) 2028 WP_000192390.1 CD3337/EF1877 family mobilome membrane protein -
  P3U43_RS13605 (P3U43_13605) - 2762106..2763128 (+) 1023 WP_000768374.1 bifunctional lytic transglycosylase/C40 family peptidase -
  P3U43_RS13610 (P3U43_13610) - 2763145..2764074 (+) 930 WP_000584387.1 conjugal transfer protein -
  P3U43_RS13615 (P3U43_13615) - 2764316..2764432 (+) 117 WP_001791010.1 tetracycline resistance determinant leader peptide -
  P3U43_RS13620 (P3U43_13620) tet(M) 2764448..2766367 (+) 1920 WP_000691737.1 tetracycline resistance ribosomal protection protein Tet(M) -
  P3U43_RS13625 (P3U43_13625) - 2766465..2766653 (+) 189 WP_032506803.1 cysteine-rich KTR domain-containing protein -
  P3U43_RS13630 (P3U43_13630) - 2766711..2767064 (-) 354 WP_001227349.1 helix-turn-helix transcriptional regulator -
  P3U43_RS13635 (P3U43_13635) - 2767596..2768018 (+) 423 WP_000804878.1 RNA polymerase sigma factor -
  P3U43_RS13640 (P3U43_13640) - 2768015..2768245 (+) 231 WP_000845144.1 helix-turn-helix domain-containing protein -
  P3U43_RS13645 (P3U43_13645) - 2768741..2768941 (+) 201 WP_000633909.1 DUF3173 domain-containing protein -
  P3U43_RS13650 (P3U43_13650) - 2768968..2770161 (+) 1194 WP_000237798.1 site-specific integrase -
  P3U43_RS13655 (P3U43_13655) guaA 2770229..2771773 (-) 1545 WP_320420723.1 glutamine-hydrolyzing GMP synthase -
  P3U43_RS13660 (P3U43_13660) guaB 2771793..2773262 (-) 1470 WP_016999221.1 IMP dehydrogenase -
  P3U43_RS13665 (P3U43_13665) - 2773297..2774565 (-) 1269 WP_064204283.1 nucleobase:cation symporter-2 family protein -
  P3U43_RS13670 (P3U43_13670) xpt 2774567..2775142 (-) 576 WP_016999220.1 xanthine phosphoribosyltransferase -
  P3U43_RS13675 (P3U43_13675) - 2775609..2776949 (+) 1341 WP_064204284.1 YsnF/AvaK domain-containing protein -
  P3U43_RS13680 (P3U43_13680) - 2777098..2777754 (+) 657 WP_016999218.1 GNAT family N-acetyltransferase -
  P3U43_RS13685 (P3U43_13685) - 2777928..2778965 (-) 1038 WP_218707045.1 nitronate monooxygenase family protein -
  P3U43_RS13690 (P3U43_13690) - 2779061..2779720 (+) 660 WP_070044836.1 nitroreductase family protein -
  P3U43_RS13695 (P3U43_13695) - 2779942..2781282 (+) 1341 WP_016999215.1 sodium-dependent transporter -
  P3U43_RS13700 (P3U43_13700) - 2781410..2782927 (-) 1518 WP_016999214.1 DASS family sodium-coupled anion symporter -
  P3U43_RS13705 (P3U43_13705) - 2783130..2784005 (+) 876 WP_064204286.1 hypothetical protein -
  P3U43_RS13710 (P3U43_13710) - 2784186..2784998 (+) 813 WP_016999212.1 hypothetical protein -
  P3U43_RS13715 (P3U43_13715) - 2785183..2785533 (+) 351 WP_201270642.1 hypothetical protein -
  P3U43_RS13720 (P3U43_13720) coaA 2785614..2786516 (+) 903 WP_016999210.1 type I pantothenate kinase -
  P3U43_RS13725 (P3U43_13725) - 2786756..2787229 (+) 474 WP_064204288.1 pyrimidine dimer DNA glycosylase/endonuclease V -
  P3U43_RS13730 (P3U43_13730) - 2787283..2787663 (+) 381 WP_257504258.1 YbgA family protein -
  P3U43_RS13735 (P3U43_13735) - 2788098..2788997 (+) 900 WP_320420742.1 Abi family protein -
  P3U43_RS13740 (P3U43_13740) rpsR 2789237..2789479 (-) 243 WP_016999205.1 30S ribosomal protein S18 -
  P3U43_RS13745 (P3U43_13745) ssbA 2789534..2790067 (-) 534 WP_320420745.1 single-stranded DNA-binding protein Machinery gene

Sequence


Protein


Download         Length: 177 a.a.        Molecular weight: 19841.57 Da        Isoelectric Point: 4.9532

>NTDB_id=802441 P3U43_RS13745 WP_320420745.1 2789534..2790067(-) (ssbA) [Mammaliicoccus lentus strain Dog127_L]
MINRVVLVGRLTKDPEYRVTPSGVQVATFTLAINRTFTNQQGEREADFINCVVFRRPAENVNNYLSKGSLAGVEGRLQSR
SYENQEGRRVYVTEVVCDSVQFLEPKGANQRQSGNDNQLYNQKNNNEFQNYGQDFGGNQQGQKAPSNQQQSNNNQQSSNP
FANANGPIDISDDDLPF

Nucleotide


Download         Length: 534 bp        

>NTDB_id=802441 P3U43_RS13745 WP_320420745.1 2789534..2790067(-) (ssbA) [Mammaliicoccus lentus strain Dog127_L]
ATGATTAATCGTGTTGTATTAGTCGGTCGGTTAACTAAAGATCCGGAATACAGAGTAACACCCTCAGGCGTTCAAGTTGC
TACTTTTACTTTAGCTATTAATCGTACTTTTACGAATCAGCAAGGTGAAAGAGAAGCTGACTTTATCAACTGTGTCGTTT
TTAGACGTCCCGCAGAGAATGTAAACAATTACTTATCTAAAGGTAGTCTTGCAGGTGTTGAAGGTCGTTTACAATCTCGT
AGCTACGAGAACCAAGAAGGTCGTCGTGTTTATGTAACTGAAGTTGTTTGTGATAGCGTTCAATTCCTTGAACCTAAAGG
CGCAAACCAACGTCAATCAGGTAATGATAACCAATTATACAACCAGAAAAATAATAACGAATTCCAAAACTATGGACAAG
ACTTTGGCGGTAACCAACAAGGCCAAAAAGCACCTTCAAATCAACAACAGTCAAATAATAATCAACAATCAAGTAACCCA
TTTGCAAATGCTAATGGACCAATTGATATCAGTGATGATGATTTGCCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.538

100

0.633

  ssb Latilactobacillus sakei subsp. sakei 23K

55.056

100

0.554

  ssb Vibrio cholerae strain A1552

35.359

100

0.362