Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | P3K42_RS06690 | Genome accession | NZ_CP119703 |
| Coordinates | 1367559..1368020 (+) | Length | 153 a.a. |
| NCBI ID | WP_100006931.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain CUVET16-335 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1359332..1399579 | 1367559..1368020 | within | 0 |
Gene organization within MGE regions
Location: 1359332..1399579
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3K42_RS06625 (P3K42_06535) | - | 1359332..1360555 (-) | 1224 | WP_153934390.1 | site-specific integrase | - |
| P3K42_RS06630 (P3K42_06540) | - | 1360614..1361255 (-) | 642 | WP_153934396.1 | hypothetical protein | - |
| P3K42_RS06635 (P3K42_06545) | - | 1361301..1361762 (-) | 462 | WP_130922120.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P3K42_RS06640 (P3K42_06550) | - | 1361781..1362113 (-) | 333 | WP_130922119.1 | helix-turn-helix domain-containing protein | - |
| P3K42_RS06645 (P3K42_06555) | - | 1362277..1362486 (+) | 210 | WP_130922118.1 | helix-turn-helix transcriptional regulator | - |
| P3K42_RS06650 (P3K42_06560) | - | 1362677..1362940 (+) | 264 | WP_153934392.1 | helix-turn-helix domain-containing protein | - |
| P3K42_RS06655 (P3K42_06565) | - | 1362955..1363131 (+) | 177 | WP_172968882.1 | hypothetical protein | - |
| P3K42_RS06660 (P3K42_06570) | - | 1363133..1363429 (+) | 297 | WP_103866757.1 | DUF2482 family protein | - |
| P3K42_RS06665 (P3K42_06575) | - | 1363516..1363773 (+) | 258 | WP_404951792.1 | DUF1108 family protein | - |
| P3K42_RS06670 (P3K42_06580) | - | 1363789..1365741 (+) | 1953 | WP_404951794.1 | AAA family ATPase | - |
| P3K42_RS06675 | - | 1365734..1365931 (+) | 198 | WP_198456198.1 | helix-turn-helix domain-containing protein | - |
| P3K42_RS06680 (P3K42_06585) | - | 1365945..1366859 (+) | 915 | WP_404951795.1 | recombinase RecT | - |
| P3K42_RS06685 (P3K42_06590) | - | 1366922..1367557 (+) | 636 | WP_100006932.1 | MBL fold metallo-hydrolase | - |
| P3K42_RS06690 (P3K42_06595) | ssb | 1367559..1368020 (+) | 462 | WP_100006931.1 | single-stranded DNA-binding protein | Machinery gene |
| P3K42_RS06695 (P3K42_06600) | - | 1368035..1368442 (+) | 408 | WP_198456199.1 | hypothetical protein | - |
| P3K42_RS06700 (P3K42_06605) | - | 1368458..1369177 (+) | 720 | WP_037542879.1 | hypothetical protein | - |
| P3K42_RS06705 (P3K42_06610) | - | 1369226..1369993 (+) | 768 | WP_049770167.1 | DnaD domain-containing protein | - |
| P3K42_RS06710 (P3K42_06615) | - | 1370008..1370790 (+) | 783 | WP_015729208.1 | ATP-binding protein | - |
| P3K42_RS06715 (P3K42_06620) | - | 1370954..1371160 (+) | 207 | WP_015729207.1 | hypothetical protein | - |
| P3K42_RS06720 (P3K42_06625) | - | 1371310..1371561 (+) | 252 | WP_015729206.1 | hypothetical protein | - |
| P3K42_RS06725 (P3K42_06630) | - | 1371594..1371788 (+) | 195 | WP_049770177.1 | SAV1978 family virulence-associated passenger protein | - |
| P3K42_RS06730 (P3K42_06635) | - | 1371794..1371979 (+) | 186 | WP_015729205.1 | hypothetical protein | - |
| P3K42_RS06735 (P3K42_06640) | - | 1371976..1372326 (+) | 351 | WP_015729204.1 | YopX family protein | - |
| P3K42_RS06740 (P3K42_06645) | - | 1372369..1372731 (+) | 363 | WP_015729203.1 | hypothetical protein | - |
| P3K42_RS06745 (P3K42_06650) | - | 1372732..1373052 (+) | 321 | WP_404951798.1 | hypothetical protein | - |
| P3K42_RS06750 (P3K42_06655) | - | 1373054..1373587 (+) | 534 | WP_015729201.1 | MazG-like family protein | - |
| P3K42_RS06755 (P3K42_06660) | - | 1373608..1374051 (+) | 444 | WP_041614853.1 | hypothetical protein | - |
| P3K42_RS06760 (P3K42_06665) | - | 1374176..1374589 (+) | 414 | WP_037542896.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| P3K42_RS06765 (P3K42_06670) | - | 1374853..1375188 (+) | 336 | WP_015729199.1 | HNH endonuclease | - |
| P3K42_RS06770 (P3K42_06675) | - | 1375324..1375623 (+) | 300 | WP_100006922.1 | P27 family phage terminase small subunit | - |
| P3K42_RS06775 (P3K42_06680) | - | 1375620..1377260 (+) | 1641 | WP_404951801.1 | terminase TerL endonuclease subunit | - |
| P3K42_RS06780 (P3K42_06685) | - | 1377275..1378429 (+) | 1155 | WP_103866786.1 | phage portal protein | - |
| P3K42_RS06785 (P3K42_06690) | - | 1378419..1379141 (+) | 723 | WP_103866788.1 | head maturation protease, ClpP-related | - |
| P3K42_RS06790 (P3K42_06695) | - | 1379170..1380297 (+) | 1128 | WP_015729194.1 | phage major capsid protein | - |
| P3K42_RS06795 (P3K42_06700) | - | 1380366..1380662 (+) | 297 | WP_015729193.1 | hypothetical protein | - |
| P3K42_RS06800 (P3K42_06705) | - | 1380643..1381005 (+) | 363 | WP_037542906.1 | hypothetical protein | - |
| P3K42_RS06805 (P3K42_06710) | - | 1381002..1381403 (+) | 402 | WP_037542908.1 | hypothetical protein | - |
| P3K42_RS06810 (P3K42_06715) | - | 1381405..1381800 (+) | 396 | WP_037542910.1 | hypothetical protein | - |
| P3K42_RS06815 (P3K42_06720) | - | 1381840..1382520 (+) | 681 | WP_103866790.1 | major tail protein | - |
| P3K42_RS06820 (P3K42_06725) | - | 1382615..1383076 (+) | 462 | WP_015729188.1 | Ig-like domain-containing protein | - |
| P3K42_RS06825 (P3K42_06730) | gpG | 1383184..1383534 (+) | 351 | WP_103866792.1 | phage tail assembly chaperone G | - |
| P3K42_RS06830 (P3K42_06735) | - | 1383576..1383731 (+) | 156 | WP_168429803.1 | hypothetical protein | - |
| P3K42_RS06835 (P3K42_06740) | - | 1383745..1389333 (+) | 5589 | WP_404951806.1 | phage tail tape measure protein | - |
| P3K42_RS06840 (P3K42_06745) | - | 1389336..1390160 (+) | 825 | WP_015729184.1 | phage tail domain-containing protein | - |
| P3K42_RS06845 (P3K42_06750) | - | 1390161..1391735 (+) | 1575 | WP_099984955.1 | prophage endopeptidase tail family protein | - |
| P3K42_RS06850 (P3K42_06755) | - | 1391722..1391922 (+) | 201 | WP_015729182.1 | hypothetical protein | - |
| P3K42_RS06855 (P3K42_06760) | - | 1391929..1392549 (+) | 621 | WP_015729181.1 | hypothetical protein | - |
| P3K42_RS06860 (P3K42_06765) | - | 1392561..1393592 (+) | 1032 | WP_037542926.1 | SGNH/GDSL hydrolase family protein | - |
| P3K42_RS06865 (P3K42_06770) | - | 1393609..1394880 (+) | 1272 | WP_037542928.1 | phage baseplate upper protein | - |
| P3K42_RS06870 (P3K42_06775) | - | 1394951..1396951 (+) | 2001 | WP_015729177.1 | BppU family phage baseplate upper protein | - |
| P3K42_RS06875 (P3K42_06780) | - | 1396963..1397394 (+) | 432 | WP_168434019.1 | holin family protein | - |
| P3K42_RS06880 (P3K42_06785) | - | 1397407..1398354 (+) | 948 | WP_214528148.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| P3K42_RS06885 (P3K42_06790) | - | 1398560..1398907 (-) | 348 | WP_100006909.1 | hypothetical protein | - |
| P3K42_RS06890 | - | 1398904..1399056 (-) | 153 | WP_100006908.1 | ribbon-helix-helix domain-containing protein | - |
| P3K42_RS06895 (P3K42_06795) | - | 1399187..1399579 (+) | 393 | WP_110148338.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 16791.61 Da Isoelectric Point: 7.8486
>NTDB_id=800589 P3K42_RS06690 WP_100006931.1 1367559..1368020(+) (ssb) [Staphylococcus pseudintermedius strain CUVET16-335]
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
Nucleotide
Download Length: 462 bp
>NTDB_id=800589 P3K42_RS06690 WP_100006931.1 1367559..1368020(+) (ssb) [Staphylococcus pseudintermedius strain CUVET16-335]
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.614 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.595 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
69.281 |
0.418 |