Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | P3K43_RS06715 | Genome accession | NZ_CP119698 |
| Coordinates | 1369771..1370232 (+) | Length | 153 a.a. |
| NCBI ID | WP_100006931.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain CUVET18-79 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1361544..1401791 | 1369771..1370232 | within | 0 |
Gene organization within MGE regions
Location: 1361544..1401791
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3K43_RS06650 (P3K43_06575) | - | 1361544..1362767 (-) | 1224 | WP_153934390.1 | site-specific integrase | - |
| P3K43_RS06655 (P3K43_06580) | - | 1362826..1363467 (-) | 642 | WP_153934396.1 | hypothetical protein | - |
| P3K43_RS06660 (P3K43_06585) | - | 1363513..1363974 (-) | 462 | WP_130922120.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P3K43_RS06665 (P3K43_06590) | - | 1363993..1364325 (-) | 333 | WP_130922119.1 | helix-turn-helix domain-containing protein | - |
| P3K43_RS06670 (P3K43_06595) | - | 1364489..1364698 (+) | 210 | WP_130922118.1 | helix-turn-helix transcriptional regulator | - |
| P3K43_RS06675 (P3K43_06600) | - | 1364889..1365152 (+) | 264 | WP_153934392.1 | helix-turn-helix domain-containing protein | - |
| P3K43_RS06680 (P3K43_06605) | - | 1365167..1365343 (+) | 177 | WP_172968882.1 | hypothetical protein | - |
| P3K43_RS06685 (P3K43_06610) | - | 1365345..1365641 (+) | 297 | WP_103866757.1 | DUF2482 family protein | - |
| P3K43_RS06690 (P3K43_06615) | - | 1365728..1365985 (+) | 258 | WP_404951792.1 | DUF1108 family protein | - |
| P3K43_RS06695 (P3K43_06620) | - | 1366001..1367953 (+) | 1953 | WP_404951794.1 | AAA family ATPase | - |
| P3K43_RS06700 | - | 1367946..1368143 (+) | 198 | WP_198456198.1 | helix-turn-helix domain-containing protein | - |
| P3K43_RS06705 (P3K43_06625) | - | 1368157..1369071 (+) | 915 | WP_404951795.1 | recombinase RecT | - |
| P3K43_RS06710 (P3K43_06630) | - | 1369134..1369769 (+) | 636 | WP_100006932.1 | MBL fold metallo-hydrolase | - |
| P3K43_RS06715 (P3K43_06635) | ssb | 1369771..1370232 (+) | 462 | WP_100006931.1 | single-stranded DNA-binding protein | Machinery gene |
| P3K43_RS06720 (P3K43_06640) | - | 1370247..1370654 (+) | 408 | WP_198456199.1 | hypothetical protein | - |
| P3K43_RS06725 (P3K43_06645) | - | 1370670..1371389 (+) | 720 | WP_037542879.1 | hypothetical protein | - |
| P3K43_RS06730 (P3K43_06650) | - | 1371438..1372205 (+) | 768 | WP_049770167.1 | DnaD domain-containing protein | - |
| P3K43_RS06735 (P3K43_06655) | - | 1372220..1373002 (+) | 783 | WP_015729208.1 | ATP-binding protein | - |
| P3K43_RS06740 (P3K43_06660) | - | 1373166..1373372 (+) | 207 | WP_015729207.1 | hypothetical protein | - |
| P3K43_RS06745 (P3K43_06665) | - | 1373522..1373773 (+) | 252 | WP_015729206.1 | hypothetical protein | - |
| P3K43_RS06750 (P3K43_06670) | - | 1373806..1374000 (+) | 195 | WP_049770177.1 | SAV1978 family virulence-associated passenger protein | - |
| P3K43_RS06755 (P3K43_06675) | - | 1374006..1374191 (+) | 186 | WP_015729205.1 | hypothetical protein | - |
| P3K43_RS06760 (P3K43_06680) | - | 1374188..1374538 (+) | 351 | WP_015729204.1 | YopX family protein | - |
| P3K43_RS06765 (P3K43_06685) | - | 1374581..1374943 (+) | 363 | WP_015729203.1 | hypothetical protein | - |
| P3K43_RS06770 (P3K43_06690) | - | 1374944..1375264 (+) | 321 | WP_404951798.1 | hypothetical protein | - |
| P3K43_RS06775 (P3K43_06695) | - | 1375266..1375799 (+) | 534 | WP_015729201.1 | MazG-like family protein | - |
| P3K43_RS06780 (P3K43_06700) | - | 1375820..1376263 (+) | 444 | WP_041614853.1 | hypothetical protein | - |
| P3K43_RS06785 (P3K43_06705) | - | 1376388..1376801 (+) | 414 | WP_037542896.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| P3K43_RS06790 (P3K43_06710) | - | 1377065..1377400 (+) | 336 | WP_015729199.1 | HNH endonuclease | - |
| P3K43_RS06795 (P3K43_06715) | - | 1377536..1377835 (+) | 300 | WP_100006922.1 | P27 family phage terminase small subunit | - |
| P3K43_RS06800 (P3K43_06720) | - | 1377832..1379472 (+) | 1641 | WP_404951801.1 | terminase TerL endonuclease subunit | - |
| P3K43_RS06805 (P3K43_06725) | - | 1379487..1380641 (+) | 1155 | WP_103866786.1 | phage portal protein | - |
| P3K43_RS06810 (P3K43_06730) | - | 1380631..1381353 (+) | 723 | WP_103866788.1 | head maturation protease, ClpP-related | - |
| P3K43_RS06815 (P3K43_06735) | - | 1381382..1382509 (+) | 1128 | WP_015729194.1 | phage major capsid protein | - |
| P3K43_RS06820 (P3K43_06740) | - | 1382578..1382874 (+) | 297 | WP_015729193.1 | hypothetical protein | - |
| P3K43_RS06825 (P3K43_06745) | - | 1382855..1383217 (+) | 363 | WP_404960235.1 | hypothetical protein | - |
| P3K43_RS06830 (P3K43_06750) | - | 1383214..1383615 (+) | 402 | WP_037542908.1 | hypothetical protein | - |
| P3K43_RS06835 (P3K43_06755) | - | 1383617..1384012 (+) | 396 | WP_037542910.1 | hypothetical protein | - |
| P3K43_RS06840 (P3K43_06760) | - | 1384052..1384732 (+) | 681 | WP_103866790.1 | major tail protein | - |
| P3K43_RS06845 (P3K43_06765) | - | 1384827..1385288 (+) | 462 | WP_015729188.1 | Ig-like domain-containing protein | - |
| P3K43_RS06850 (P3K43_06770) | gpG | 1385396..1385746 (+) | 351 | WP_103866792.1 | phage tail assembly chaperone G | - |
| P3K43_RS06855 (P3K43_06775) | - | 1385788..1385943 (+) | 156 | WP_168429803.1 | hypothetical protein | - |
| P3K43_RS06860 (P3K43_06780) | - | 1385957..1391545 (+) | 5589 | WP_404951806.1 | phage tail tape measure protein | - |
| P3K43_RS06865 (P3K43_06785) | - | 1391548..1392372 (+) | 825 | WP_015729184.1 | phage tail domain-containing protein | - |
| P3K43_RS06870 (P3K43_06790) | - | 1392373..1393947 (+) | 1575 | WP_099984955.1 | prophage endopeptidase tail family protein | - |
| P3K43_RS06875 (P3K43_06795) | - | 1393934..1394134 (+) | 201 | WP_015729182.1 | hypothetical protein | - |
| P3K43_RS06880 (P3K43_06800) | - | 1394141..1394761 (+) | 621 | WP_015729181.1 | hypothetical protein | - |
| P3K43_RS06885 | - | 1394773..1395804 (+) | 1032 | Protein_1321 | SGNH/GDSL hydrolase family protein | - |
| P3K43_RS06890 (P3K43_06815) | - | 1395821..1397092 (+) | 1272 | WP_037542928.1 | phage baseplate upper protein | - |
| P3K43_RS06895 (P3K43_06820) | - | 1397163..1399163 (+) | 2001 | WP_015729177.1 | BppU family phage baseplate upper protein | - |
| P3K43_RS06900 (P3K43_06825) | - | 1399175..1399606 (+) | 432 | WP_168434019.1 | holin family protein | - |
| P3K43_RS06905 (P3K43_06830) | - | 1399619..1400566 (+) | 948 | WP_214528148.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| P3K43_RS06910 (P3K43_06835) | - | 1400772..1401119 (-) | 348 | WP_100006909.1 | hypothetical protein | - |
| P3K43_RS06915 | - | 1401116..1401268 (-) | 153 | WP_100006908.1 | ribbon-helix-helix domain-containing protein | - |
| P3K43_RS06920 (P3K43_06840) | - | 1401399..1401791 (+) | 393 | WP_110148338.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 16791.61 Da Isoelectric Point: 7.8486
>NTDB_id=800525 P3K43_RS06715 WP_100006931.1 1369771..1370232(+) (ssb) [Staphylococcus pseudintermedius strain CUVET18-79]
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
Nucleotide
Download Length: 462 bp
>NTDB_id=800525 P3K43_RS06715 WP_100006931.1 1369771..1370232(+) (ssb) [Staphylococcus pseudintermedius strain CUVET18-79]
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.614 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.595 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
69.281 |
0.418 |