Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | P3K37_RS06675 | Genome accession | NZ_CP119695 |
| Coordinates | 1361485..1361946 (+) | Length | 153 a.a. |
| NCBI ID | WP_100006931.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain CUVET16-803 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1353258..1393505 | 1361485..1361946 | within | 0 |
Gene organization within MGE regions
Location: 1353258..1393505
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3K37_RS06610 (P3K37_06520) | - | 1353258..1354481 (-) | 1224 | WP_153934390.1 | site-specific integrase | - |
| P3K37_RS06615 (P3K37_06525) | - | 1354540..1355181 (-) | 642 | WP_153934396.1 | hypothetical protein | - |
| P3K37_RS06620 (P3K37_06530) | - | 1355227..1355688 (-) | 462 | WP_130922120.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P3K37_RS06625 (P3K37_06535) | - | 1355707..1356039 (-) | 333 | WP_130922119.1 | helix-turn-helix domain-containing protein | - |
| P3K37_RS06630 (P3K37_06540) | - | 1356203..1356412 (+) | 210 | WP_130922118.1 | helix-turn-helix transcriptional regulator | - |
| P3K37_RS06635 (P3K37_06545) | - | 1356603..1356866 (+) | 264 | WP_153934392.1 | helix-turn-helix domain-containing protein | - |
| P3K37_RS06640 (P3K37_06550) | - | 1356881..1357057 (+) | 177 | WP_172968882.1 | hypothetical protein | - |
| P3K37_RS06645 (P3K37_06555) | - | 1357059..1357355 (+) | 297 | WP_103866757.1 | DUF2482 family protein | - |
| P3K37_RS06650 (P3K37_06560) | - | 1357442..1357699 (+) | 258 | WP_404951792.1 | DUF1108 family protein | - |
| P3K37_RS06655 (P3K37_06565) | - | 1357715..1359667 (+) | 1953 | WP_404951794.1 | AAA family ATPase | - |
| P3K37_RS06660 | - | 1359660..1359857 (+) | 198 | WP_198456198.1 | helix-turn-helix domain-containing protein | - |
| P3K37_RS06665 (P3K37_06570) | - | 1359871..1360785 (+) | 915 | WP_404951795.1 | recombinase RecT | - |
| P3K37_RS06670 (P3K37_06575) | - | 1360848..1361483 (+) | 636 | WP_100006932.1 | MBL fold metallo-hydrolase | - |
| P3K37_RS06675 (P3K37_06580) | ssb | 1361485..1361946 (+) | 462 | WP_100006931.1 | single-stranded DNA-binding protein | Machinery gene |
| P3K37_RS06680 (P3K37_06585) | - | 1361961..1362368 (+) | 408 | WP_198456199.1 | hypothetical protein | - |
| P3K37_RS06685 (P3K37_06590) | - | 1362384..1363103 (+) | 720 | WP_037542879.1 | hypothetical protein | - |
| P3K37_RS06690 (P3K37_06595) | - | 1363152..1363919 (+) | 768 | WP_049770167.1 | DnaD domain-containing protein | - |
| P3K37_RS06695 (P3K37_06600) | - | 1363934..1364716 (+) | 783 | WP_015729208.1 | ATP-binding protein | - |
| P3K37_RS06700 (P3K37_06605) | - | 1364880..1365086 (+) | 207 | WP_015729207.1 | hypothetical protein | - |
| P3K37_RS06705 (P3K37_06610) | - | 1365236..1365487 (+) | 252 | WP_015729206.1 | hypothetical protein | - |
| P3K37_RS06710 (P3K37_06615) | - | 1365520..1365714 (+) | 195 | WP_049770177.1 | SAV1978 family virulence-associated passenger protein | - |
| P3K37_RS06715 (P3K37_06620) | - | 1365720..1365905 (+) | 186 | WP_015729205.1 | hypothetical protein | - |
| P3K37_RS06720 (P3K37_06625) | - | 1365902..1366252 (+) | 351 | WP_015729204.1 | YopX family protein | - |
| P3K37_RS06725 (P3K37_06630) | - | 1366295..1366657 (+) | 363 | WP_015729203.1 | hypothetical protein | - |
| P3K37_RS06730 (P3K37_06635) | - | 1366658..1366978 (+) | 321 | WP_404951798.1 | hypothetical protein | - |
| P3K37_RS06735 (P3K37_06640) | - | 1366980..1367513 (+) | 534 | WP_015729201.1 | MazG-like family protein | - |
| P3K37_RS06740 (P3K37_06645) | - | 1367534..1367977 (+) | 444 | WP_041614853.1 | hypothetical protein | - |
| P3K37_RS06745 (P3K37_06650) | - | 1368102..1368515 (+) | 414 | WP_037542896.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| P3K37_RS06750 (P3K37_06655) | - | 1368779..1369114 (+) | 336 | WP_015729199.1 | HNH endonuclease | - |
| P3K37_RS06755 (P3K37_06660) | - | 1369250..1369549 (+) | 300 | WP_100006922.1 | P27 family phage terminase small subunit | - |
| P3K37_RS06760 (P3K37_06665) | - | 1369546..1371186 (+) | 1641 | WP_404951801.1 | terminase TerL endonuclease subunit | - |
| P3K37_RS06765 (P3K37_06670) | - | 1371201..1372355 (+) | 1155 | WP_103866786.1 | phage portal protein | - |
| P3K37_RS06770 (P3K37_06675) | - | 1372345..1373067 (+) | 723 | WP_103866788.1 | head maturation protease, ClpP-related | - |
| P3K37_RS06775 (P3K37_06680) | - | 1373096..1374223 (+) | 1128 | WP_015729194.1 | phage major capsid protein | - |
| P3K37_RS06780 (P3K37_06685) | - | 1374292..1374588 (+) | 297 | WP_015729193.1 | hypothetical protein | - |
| P3K37_RS06785 (P3K37_06690) | - | 1374569..1374931 (+) | 363 | WP_037542906.1 | hypothetical protein | - |
| P3K37_RS06790 (P3K37_06695) | - | 1374928..1375329 (+) | 402 | WP_037542908.1 | hypothetical protein | - |
| P3K37_RS06795 (P3K37_06700) | - | 1375331..1375726 (+) | 396 | WP_037542910.1 | hypothetical protein | - |
| P3K37_RS06800 (P3K37_06705) | - | 1375766..1376446 (+) | 681 | WP_103866790.1 | major tail protein | - |
| P3K37_RS06805 (P3K37_06710) | - | 1376541..1377002 (+) | 462 | WP_015729188.1 | Ig-like domain-containing protein | - |
| P3K37_RS06810 (P3K37_06715) | gpG | 1377110..1377460 (+) | 351 | WP_103866792.1 | phage tail assembly chaperone G | - |
| P3K37_RS06815 (P3K37_06720) | - | 1377502..1377657 (+) | 156 | WP_168429803.1 | hypothetical protein | - |
| P3K37_RS06820 (P3K37_06725) | - | 1377671..1383259 (+) | 5589 | WP_404951806.1 | phage tail tape measure protein | - |
| P3K37_RS06825 (P3K37_06730) | - | 1383262..1384086 (+) | 825 | WP_015729184.1 | phage tail domain-containing protein | - |
| P3K37_RS06830 (P3K37_06735) | - | 1384087..1385661 (+) | 1575 | WP_099984955.1 | prophage endopeptidase tail family protein | - |
| P3K37_RS06835 (P3K37_06740) | - | 1385648..1385848 (+) | 201 | WP_015729182.1 | hypothetical protein | - |
| P3K37_RS06840 (P3K37_06745) | - | 1385855..1386475 (+) | 621 | WP_015729181.1 | hypothetical protein | - |
| P3K37_RS06845 (P3K37_06750) | - | 1386487..1387518 (+) | 1032 | WP_037542926.1 | SGNH/GDSL hydrolase family protein | - |
| P3K37_RS06850 (P3K37_06755) | - | 1387535..1388806 (+) | 1272 | WP_037542928.1 | phage baseplate upper protein | - |
| P3K37_RS06855 (P3K37_06760) | - | 1388877..1390877 (+) | 2001 | WP_015729177.1 | BppU family phage baseplate upper protein | - |
| P3K37_RS06860 (P3K37_06765) | - | 1390889..1391320 (+) | 432 | WP_168434019.1 | holin family protein | - |
| P3K37_RS06865 (P3K37_06770) | - | 1391333..1392280 (+) | 948 | WP_214528148.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| P3K37_RS06870 (P3K37_06775) | - | 1392486..1392833 (-) | 348 | WP_100006909.1 | hypothetical protein | - |
| P3K37_RS06875 | - | 1392830..1392982 (-) | 153 | WP_100006908.1 | ribbon-helix-helix domain-containing protein | - |
| P3K37_RS06880 (P3K37_06780) | - | 1393113..1393505 (+) | 393 | WP_110148338.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 16791.61 Da Isoelectric Point: 7.8486
>NTDB_id=800493 P3K37_RS06675 WP_100006931.1 1361485..1361946(+) (ssb) [Staphylococcus pseudintermedius strain CUVET16-803]
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
Nucleotide
Download Length: 462 bp
>NTDB_id=800493 P3K37_RS06675 WP_100006931.1 1361485..1361946(+) (ssb) [Staphylococcus pseudintermedius strain CUVET16-803]
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.614 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.595 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
69.281 |
0.418 |