Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   PX690_RS03405 Genome accession   NZ_CP119675
Coordinates   608355..608732 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain 160     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 603355..613732
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PX690_RS03365 (PX690_03365) - 603854..604648 (+) 795 WP_014305407.1 YqhG family protein -
  PX690_RS03370 (PX690_03370) sinI 604825..604998 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  PX690_RS03375 (PX690_03375) sinR 605032..605367 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PX690_RS03380 (PX690_03380) - 605415..606200 (-) 786 WP_015388008.1 TasA family protein -
  PX690_RS03385 (PX690_03385) - 606264..606848 (-) 585 WP_012117977.1 signal peptidase I -
  PX690_RS03390 (PX690_03390) tapA 606820..607491 (-) 672 WP_276123466.1 amyloid fiber anchoring/assembly protein TapA -
  PX690_RS03395 (PX690_03395) - 607750..608079 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PX690_RS03400 (PX690_03400) - 608119..608298 (-) 180 WP_003153093.1 YqzE family protein -
  PX690_RS03405 (PX690_03405) comGG 608355..608732 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  PX690_RS03410 (PX690_03410) comGF 608733..609233 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  PX690_RS03415 (PX690_03415) comGE 609142..609456 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  PX690_RS03420 (PX690_03420) comGD 609440..609877 (-) 438 WP_224462754.1 competence type IV pilus minor pilin ComGD Machinery gene
  PX690_RS03425 (PX690_03425) comGC 609867..610133 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  PX690_RS03430 (PX690_03430) comGB 610180..611217 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  PX690_RS03435 (PX690_03435) comGA 611204..612274 (-) 1071 WP_276123467.1 competence type IV pilus ATPase ComGA Machinery gene
  PX690_RS03440 (PX690_03440) - 612466..613416 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=800158 PX690_RS03405 WP_014305410.1 608355..608732(-) (comGG) [Bacillus velezensis strain 160]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=800158 PX690_RS03405 WP_014305410.1 608355..608732(-) (comGG) [Bacillus velezensis strain 160]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512