Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   PX690_RS03370 Genome accession   NZ_CP119675
Coordinates   604825..604998 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 160     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 599825..609998
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PX690_RS03355 (PX690_03355) gcvT 600643..601743 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  PX690_RS03360 (PX690_03360) - 602166..603836 (+) 1671 WP_058906183.1 SNF2-related protein -
  PX690_RS03365 (PX690_03365) - 603854..604648 (+) 795 WP_014305407.1 YqhG family protein -
  PX690_RS03370 (PX690_03370) sinI 604825..604998 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  PX690_RS03375 (PX690_03375) sinR 605032..605367 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PX690_RS03380 (PX690_03380) - 605415..606200 (-) 786 WP_015388008.1 TasA family protein -
  PX690_RS03385 (PX690_03385) - 606264..606848 (-) 585 WP_012117977.1 signal peptidase I -
  PX690_RS03390 (PX690_03390) tapA 606820..607491 (-) 672 WP_276123466.1 amyloid fiber anchoring/assembly protein TapA -
  PX690_RS03395 (PX690_03395) - 607750..608079 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PX690_RS03400 (PX690_03400) - 608119..608298 (-) 180 WP_003153093.1 YqzE family protein -
  PX690_RS03405 (PX690_03405) comGG 608355..608732 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  PX690_RS03410 (PX690_03410) comGF 608733..609233 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  PX690_RS03415 (PX690_03415) comGE 609142..609456 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  PX690_RS03420 (PX690_03420) comGD 609440..609877 (-) 438 WP_224462754.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=800156 PX690_RS03370 WP_003153105.1 604825..604998(+) (sinI) [Bacillus velezensis strain 160]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=800156 PX690_RS03370 WP_003153105.1 604825..604998(+) (sinI) [Bacillus velezensis strain 160]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702