Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   P1K87_RS11775 Genome accession   NZ_CP119596
Coordinates   2452572..2453009 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain MG-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2447572..2458009
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P1K87_RS11725 (P1K87_11725) sinI 2447955..2448128 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  P1K87_RS11730 (P1K87_11730) sinR 2448162..2448497 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P1K87_RS11735 (P1K87_11735) - 2448545..2449330 (-) 786 WP_032874027.1 TasA family protein -
  P1K87_RS11740 (P1K87_11740) - 2449395..2449979 (-) 585 WP_032874025.1 signal peptidase I -
  P1K87_RS11745 (P1K87_11745) tapA 2449951..2450622 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  P1K87_RS11750 (P1K87_11750) - 2450881..2451210 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  P1K87_RS11755 (P1K87_11755) - 2451251..2451430 (-) 180 WP_022552966.1 YqzE family protein -
  P1K87_RS11760 (P1K87_11760) comGG 2451487..2451864 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  P1K87_RS11765 (P1K87_11765) comGF 2451865..2452365 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  P1K87_RS11770 (P1K87_11770) comGE 2452274..2452588 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  P1K87_RS11775 (P1K87_11775) comGD 2452572..2453009 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  P1K87_RS11780 (P1K87_11780) comGC 2452999..2453307 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  P1K87_RS11785 (P1K87_11785) comGB 2453312..2454349 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  P1K87_RS11790 (P1K87_11790) comGA 2454336..2455406 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  P1K87_RS11795 (P1K87_11795) - 2455603..2456553 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  P1K87_RS11800 (P1K87_11800) - 2456699..2458000 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=799900 P1K87_RS11775 WP_007612572.1 2452572..2453009(-) (comGD) [Bacillus amyloliquefaciens strain MG-2]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=799900 P1K87_RS11775 WP_007612572.1 2452572..2453009(-) (comGD) [Bacillus amyloliquefaciens strain MG-2]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559