Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | PZ486_RS06310 | Genome accession | NZ_CP119571 |
| Coordinates | 1234837..1235265 (-) | Length | 142 a.a. |
| NCBI ID | WP_031886357.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain N08CSA36 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1194948..1243630 | 1234837..1235265 | within | 0 |
Gene organization within MGE regions
Location: 1194948..1243630
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PZ486_RS06025 (PZ486_06025) | - | 1194948..1195463 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| PZ486_RS06030 (PZ486_06030) | - | 1195594..1195755 (-) | 162 | WP_001005407.1 | SE1561 family protein | - |
| PZ486_RS06035 (PZ486_06035) | - | 1196102..1196182 (+) | 81 | WP_100250272.1 | hypothetical protein | - |
| PZ486_RS06040 (PZ486_06040) | - | 1196912..1197412 (+) | 501 | WP_113559807.1 | hypothetical protein | - |
| PZ486_RS06045 (PZ486_06045) | - | 1197502..1198947 (-) | 1446 | WP_031883912.1 | SH3 domain-containing protein | - |
| PZ486_RS06050 (PZ486_06050) | - | 1198928..1199365 (-) | 438 | WP_031883911.1 | phage holin | - |
| PZ486_RS06055 (PZ486_06055) | - | 1199501..1199800 (-) | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
| PZ486_RS06060 (PZ486_06060) | - | 1199846..1200010 (-) | 165 | WP_000916020.1 | XkdX family protein | - |
| PZ486_RS06065 (PZ486_06065) | - | 1200003..1200392 (-) | 390 | WP_001166599.1 | DUF2977 domain-containing protein | - |
| PZ486_RS06070 (PZ486_06070) | - | 1200392..1201858 (-) | 1467 | WP_276097502.1 | BppU family phage baseplate upper protein | - |
| PZ486_RS06075 (PZ486_06075) | - | 1201858..1203768 (-) | 1911 | WP_000429558.1 | minor structural protein | - |
| PZ486_RS06080 (PZ486_06080) | - | 1203784..1204074 (-) | 291 | WP_000179860.1 | hypothetical protein | - |
| PZ486_RS06085 (PZ486_06085) | - | 1204074..1205657 (-) | 1584 | WP_276097438.1 | prophage endopeptidase tail family protein | - |
| PZ486_RS06090 (PZ486_06090) | - | 1205666..1206490 (-) | 825 | WP_001190533.1 | phage tail family protein | - |
| PZ486_RS06095 (PZ486_06095) | - | 1206490..1212690 (-) | 6201 | WP_276097437.1 | phage tail tape measure protein | - |
| PZ486_RS06100 (PZ486_06100) | - | 1212704..1212862 (-) | 159 | WP_000438833.1 | hypothetical protein | - |
| PZ486_RS06105 (PZ486_06105) | - | 1212904..1213254 (-) | 351 | WP_000589167.1 | hypothetical protein | - |
| PZ486_RS06110 (PZ486_06110) | - | 1213312..1213767 (-) | 456 | WP_053865771.1 | Ig-like domain-containing protein | - |
| PZ486_RS06115 (PZ486_06115) | - | 1213859..1214500 (-) | 642 | WP_000807542.1 | major tail protein | - |
| PZ486_RS06120 (PZ486_06120) | - | 1214535..1214930 (-) | 396 | WP_001636966.1 | DUF3168 domain-containing protein | - |
| PZ486_RS06125 (PZ486_06125) | - | 1214931..1215332 (-) | 402 | WP_000110019.1 | hypothetical protein | - |
| PZ486_RS06130 (PZ486_06130) | - | 1215329..1215661 (-) | 333 | WP_031838176.1 | phage protein | - |
| PZ486_RS06135 (PZ486_06135) | - | 1215673..1215951 (-) | 279 | WP_000050973.1 | head-tail connector protein | - |
| PZ486_RS06140 (PZ486_06140) | - | 1216020..1217183 (-) | 1164 | WP_001142738.1 | phage major capsid protein | - |
| PZ486_RS06145 (PZ486_06145) | - | 1217195..1217968 (-) | 774 | WP_000061867.1 | head maturation protease, ClpP-related | - |
| PZ486_RS06150 (PZ486_06150) | - | 1217952..1219190 (-) | 1239 | WP_001100669.1 | phage portal protein | - |
| PZ486_RS06155 (PZ486_06155) | - | 1219195..1220886 (-) | 1692 | WP_031886315.1 | terminase TerL endonuclease subunit | - |
| PZ486_RS06160 (PZ486_06160) | - | 1220876..1221181 (-) | 306 | WP_000778933.1 | P27 family phage terminase small subunit | - |
| PZ486_RS06165 (PZ486_06165) | - | 1221309..1221623 (-) | 315 | WP_015978060.1 | HNH endonuclease | - |
| PZ486_RS06170 (PZ486_06170) | - | 1221780..1222217 (-) | 438 | WP_129409669.1 | transcriptional regulator | - |
| PZ486_RS06175 (PZ486_06175) | - | 1222230..1223597 (-) | 1368 | WP_078098969.1 | DEAD/DEAH box helicase | - |
| PZ486_RS06180 (PZ486_06180) | - | 1223578..1223868 (-) | 291 | WP_000665205.1 | VRR-NUC domain-containing protein | - |
| PZ486_RS06185 (PZ486_06185) | - | 1224002..1224106 (+) | 105 | WP_078098968.1 | hypothetical protein | - |
| PZ486_RS06190 (PZ486_06190) | - | 1224208..1226655 (-) | 2448 | WP_276097504.1 | virulence-associated E family protein | - |
| PZ486_RS06195 (PZ486_06195) | - | 1226707..1226907 (-) | 201 | WP_000265258.1 | DUF1514 family protein | - |
| PZ486_RS06200 (PZ486_06200) | - | 1226975..1227127 (-) | 153 | WP_045179128.1 | transcriptional activator RinB | - |
| PZ486_RS06205 (PZ486_06205) | - | 1227124..1227513 (-) | 390 | WP_025174390.1 | hypothetical protein | - |
| PZ486_RS06210 (PZ486_06210) | - | 1227503..1227739 (-) | 237 | WP_000608279.1 | hypothetical protein | - |
| PZ486_RS06215 (PZ486_06215) | - | 1227732..1228019 (-) | 288 | WP_244053037.1 | DUF1381 domain-containing protein | - |
| PZ486_RS06220 (PZ486_06220) | - | 1228056..1228562 (-) | 507 | WP_001061834.1 | dUTPase | - |
| PZ486_RS06225 (PZ486_06225) | - | 1228577..1228738 (-) | 162 | WP_000889680.1 | hypothetical protein | - |
| PZ486_RS06230 (PZ486_06230) | - | 1228739..1228912 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| PZ486_RS06235 (PZ486_06235) | - | 1228902..1229153 (-) | 252 | WP_031886311.1 | DUF1024 family protein | - |
| PZ486_RS06240 (PZ486_06240) | - | 1229146..1229454 (-) | 309 | WP_276097435.1 | hypothetical protein | - |
| PZ486_RS06245 (PZ486_06245) | - | 1229451..1229798 (-) | 348 | WP_000979209.1 | YopX family protein | - |
| PZ486_RS06250 (PZ486_06250) | - | 1229795..1230202 (-) | 408 | WP_000695770.1 | hypothetical protein | - |
| PZ486_RS06255 (PZ486_06255) | - | 1230205..1230411 (-) | 207 | WP_021285869.1 | hypothetical protein | - |
| PZ486_RS06260 (PZ486_06260) | - | 1230426..1230674 (-) | 249 | WP_078069534.1 | SAV1978 family virulence-associated passenger protein | - |
| PZ486_RS06265 (PZ486_06265) | - | 1230674..1230928 (-) | 255 | WP_021285871.1 | DUF3310 domain-containing protein | - |
| PZ486_RS06270 (PZ486_06270) | - | 1230928..1231545 (-) | 618 | WP_021285872.1 | SA1788 family PVL leukocidin-associated protein | - |
| PZ486_RS06275 (PZ486_06275) | - | 1231546..1231731 (-) | 186 | WP_276097506.1 | DUF3113 family protein | - |
| PZ486_RS06280 (PZ486_06280) | - | 1231731..1232138 (-) | 408 | WP_215347278.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PZ486_RS06285 (PZ486_06285) | - | 1232148..1232369 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| PZ486_RS06290 (PZ486_06290) | - | 1232382..1232540 (-) | 159 | WP_000628839.1 | hypothetical protein | - |
| PZ486_RS06295 (PZ486_06295) | - | 1232537..1233322 (-) | 786 | WP_024273306.1 | ATP-binding protein | - |
| PZ486_RS06300 (PZ486_06300) | - | 1233335..1234156 (-) | 822 | WP_031886356.1 | phage replisome organizer N-terminal domain-containing protein | - |
| PZ486_RS06305 (PZ486_06305) | - | 1234128..1234823 (-) | 696 | WP_001121808.1 | putative HNHc nuclease | - |
| PZ486_RS06310 (PZ486_06310) | ssbA | 1234837..1235265 (-) | 429 | WP_031886357.1 | single-stranded DNA-binding protein | Machinery gene |
| PZ486_RS06315 (PZ486_06315) | - | 1235265..1235888 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| PZ486_RS06320 (PZ486_06320) | - | 1235881..1236102 (-) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| PZ486_RS06325 (PZ486_06325) | - | 1236112..1236372 (-) | 261 | WP_031886358.1 | DUF1108 family protein | - |
| PZ486_RS06330 (PZ486_06330) | - | 1236377..1236679 (-) | 303 | WP_000165363.1 | DUF2482 family protein | - |
| PZ486_RS06335 (PZ486_06335) | - | 1236772..1236933 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| PZ486_RS06340 (PZ486_06340) | - | 1236926..1237147 (-) | 222 | WP_000594790.1 | hypothetical protein | - |
| PZ486_RS06345 (PZ486_06345) | - | 1237219..1237872 (+) | 654 | WP_031886359.1 | hypothetical protein | - |
| PZ486_RS06350 (PZ486_06350) | - | 1237882..1238025 (-) | 144 | WP_000939498.1 | hypothetical protein | - |
| PZ486_RS06355 (PZ486_06355) | - | 1238054..1238830 (-) | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| PZ486_RS06360 (PZ486_06360) | - | 1238844..1239080 (-) | 237 | WP_001121027.1 | helix-turn-helix transcriptional regulator | - |
| PZ486_RS06365 (PZ486_06365) | - | 1239232..1239546 (+) | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | - |
| PZ486_RS06370 (PZ486_06370) | - | 1239559..1240020 (+) | 462 | WP_129409664.1 | toxin | - |
| PZ486_RS06375 (PZ486_06375) | - | 1240039..1240542 (+) | 504 | WP_129409663.1 | hypothetical protein | - |
| PZ486_RS06380 (PZ486_06380) | - | 1240604..1241650 (+) | 1047 | WP_031886361.1 | tyrosine-type recombinase/integrase | - |
| PZ486_RS06385 (PZ486_06385) | yfkAB | 1241695..1242840 (+) | 1146 | WP_057511308.1 | radical SAM/CxCxxxxC motif protein YfkAB | - |
| PZ486_RS06390 (PZ486_06390) | - | 1243100..1243630 (-) | 531 | WP_000184383.1 | acyl-CoA thioesterase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15918.61 Da Isoelectric Point: 8.4825
>NTDB_id=799672 PZ486_RS06310 WP_031886357.1 1234837..1235265(-) (ssbA) [Staphylococcus aureus strain N08CSA36]
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=799672 PZ486_RS06310 WP_031886357.1 1234837..1235265(-) (ssbA) [Staphylococcus aureus strain N08CSA36]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATTAAGAAGCACACCGAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGTGAGCGTGAAGCAGACTTTATTAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTATCTTTCTAAAGGATCACTGGCAGGTGTTGACGGACGATTACAAACACGT
AGCTACGATAACAAAGTCGGGCAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATTAAGAAGCACACCGAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGTGAGCGTGAAGCAGACTTTATTAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTATCTTTCTAAAGGATCACTGGCAGGTGTTGACGGACGATTACAAACACGT
AGCTACGATAACAAAGTCGGGCAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |