Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   PZB78_RS10065 Genome accession   NZ_CP119073
Coordinates   1969482..1969865 (-) Length   127 a.a.
NCBI ID   WP_038954226.1    Uniprot ID   -
Organism   Bacillus halotolerans strain SW207     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1964482..1974865
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PZB78_RS10025 (PZB78_09990) sinI 1965416..1965589 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  PZB78_RS10030 (PZB78_09995) sinR 1965623..1965958 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PZB78_RS10035 (PZB78_10000) tasA 1966045..1966830 (-) 786 WP_106020091.1 biofilm matrix protein TasA -
  PZB78_RS10040 (PZB78_10005) sipW 1966895..1967479 (-) 585 WP_105955579.1 signal peptidase I SipW -
  PZB78_RS10045 (PZB78_10010) tapA 1967451..1968212 (-) 762 WP_106020093.1 amyloid fiber anchoring/assembly protein TapA -
  PZB78_RS10050 (PZB78_10015) - 1968490..1968813 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  PZB78_RS10055 (PZB78_10020) - 1968856..1969035 (-) 180 WP_003236949.1 YqzE family protein -
  PZB78_RS10060 (PZB78_10025) comGG 1969107..1969481 (-) 375 WP_106020094.1 competence type IV pilus minor pilin ComGG Machinery gene
  PZB78_RS10065 (PZB78_10030) comGF 1969482..1969865 (-) 384 WP_038954226.1 competence type IV pilus minor pilin ComGF Machinery gene
  PZB78_RS10070 (PZB78_10035) comGE 1969891..1970238 (-) 348 WP_106020095.1 competence type IV pilus minor pilin ComGE Machinery gene
  PZB78_RS10075 (PZB78_10040) comGD 1970222..1970653 (-) 432 WP_255003480.1 competence type IV pilus minor pilin ComGD Machinery gene
  PZB78_RS10080 (PZB78_10045) comGC 1970643..1970939 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  PZB78_RS10085 (PZB78_10050) comGB 1970953..1971990 (-) 1038 WP_106020096.1 competence type IV pilus assembly protein ComGB Machinery gene
  PZB78_RS10090 (PZB78_10055) comGA 1971977..1973047 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  PZB78_RS10095 (PZB78_10060) - 1973368..1973778 (-) 411 WP_106020097.1 CBS domain-containing protein -
  PZB78_RS10100 (PZB78_10065) - 1973841..1974794 (-) 954 WP_255003483.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14587.79 Da        Isoelectric Point: 7.9272

>NTDB_id=797478 PZB78_RS10065 WP_038954226.1 1969482..1969865(-) (comGF) [Bacillus halotolerans strain SW207]
MLISGSLAIFFHLFLSRQQENEGFMQREWVISVEQIMNECKQSQTVQTDEHGSVLICRNLSGQEVRFEIYHSMIRKRVDG
KGHVPILDHIKTMKAGVKNGMLWLKVKNENDKEYQTAFPVYTSLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=797478 PZB78_RS10065 WP_038954226.1 1969482..1969865(-) (comGF) [Bacillus halotolerans strain SW207]
TTGCTCATATCAGGATCGTTAGCGATATTCTTTCATCTATTTTTGTCACGTCAACAGGAGAATGAGGGCTTCATGCAGCG
GGAATGGGTCATTTCGGTAGAGCAGATCATGAATGAGTGCAAGCAGTCGCAGACAGTGCAGACAGATGAGCATGGCAGCG
TCTTAATCTGCAGAAATCTGTCAGGGCAAGAGGTCCGTTTTGAAATCTACCATTCAATGATCAGAAAAAGAGTAGACGGA
AAAGGGCATGTTCCGATTCTTGATCATATTAAAACAATGAAAGCCGGGGTTAAAAACGGGATGCTTTGGCTGAAAGTCAA
GAATGAGAATGATAAAGAGTATCAAACCGCTTTTCCGGTATATACGTCGTTAGGAGGTGGGTGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

73.228

100

0.732