Detailed information NTG0797027

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: PYW39_RS11575
• Genome accession: NZ_CP118973
• Coordinates: 2355506..2356021 (-)
• Length: 171 a.a.
• NCBI ID: WP_002466536.1
• Uniprot ID: A0A2V3ZFL8
• Organism: Staphylococcus warneri strain DSM 20316
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2344583..2357536	2355506..2356021	within	0

Gene organization within MGE regions

Location: 2344583..2357536

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYW39_RS11505	-	2344583..2345068 (-)	486	WP_049416686.1	terminase small subunit	-
PYW39_RS11510	-	2345125..2345427 (-)	303	WP_049416685.1	hypothetical protein	-
PYW39_RS11515	-	2345420..2346016 (-)	597	WP_049416683.1	pathogenicity island protein	-
PYW39_RS11520	-	2346030..2346791 (-)	762	WP_049416681.1	hypothetical protein	-
PYW39_RS11525	-	2346803..2347147 (-)	345	WP_049416679.1	hypothetical protein	-
PYW39_RS11530	-	2347433..2348074 (-)	642	WP_049416676.1	pathogenicity island protein	-
PYW39_RS11535	-	2348071..2348421 (-)	351	WP_049416674.1	hypothetical protein	-
PYW39_RS11540	-	2348693..2350945 (-)	2253	Protein_2222	phage/plasmid primase, P4 family	-
PYW39_RS11545	-	2351042..2351383 (-)	342	WP_049416672.1	hypothetical protein	-
PYW39_RS11550	-	2351385..2351744 (-)	360	WP_049416671.1	hypothetical protein	-
PYW39_RS11555	-	2351773..2352309 (+)	537	WP_049416668.1	hypothetical protein	-
PYW39_RS11560	-	2352377..2353765 (+)	1389	WP_049416667.1	SAP domain-containing protein	-
PYW39_RS11565	-	2353779..2355002 (+)	1224	WP_049416665.1	tyrosine-type recombinase/integrase	-
PYW39_RS11570	rpsR	2355219..2355461 (-)	243	WP_002451519.1	30S ribosomal protein S18	-
PYW39_RS11575	ssbA	2355506..2356021 (-)	516	WP_002466536.1	single-stranded DNA-binding protein	Machinery gene
PYW39_RS11580	rpsF	2356043..2356339 (-)	297	WP_002451521.1	30S ribosomal protein S6	-
PYW39_RS11585	-	2356715..2357536 (+)	822	WP_002466546.1	GH25 family lysozyme	-

Sequence

Protein

• Length: 171 a.a.
• Molecular weight: 18856.42 Da
• Isoelectric Point: 4.7410

>NTDB_id=797027 PYW39_RS11575 WP_002466536.1 2355506..2356021(-) (ssbA) [Staphylococcus warneri strain DSM 20316]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQAENVNNYLSKGSLAGVDGRIQSR
SYENQEGRRIFVTEVVCDSVQFLEPKNSQNGGGQRSQNNEFQDYGQGFGGQQSGQNTSYNNNSSKPNSNQSDNPFANANG
PIDISDDDLPF

Nucleotide

• Length: 516 bp

>NTDB_id=797027 PYW39_RS11575 WP_002466536.1 2355506..2356021(-) (ssbA) [Staphylococcus warneri strain DSM 20316]
ATGTTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCAGAATACAGAACCACTCCCTCAGGCGTAAGTGTAGC
GACATTTACTCTAGCAGTTAATCGTACTTTCACGAATGCTCAAGGGGAACGCGAAGCAGATTTCATTAACTGTGTTGTTT
TCAGAAGACAAGCAGAAAATGTAAATAACTACTTATCTAAAGGTAGTTTAGCTGGCGTTGATGGTCGCATACAGTCACGT
AGTTATGAAAATCAAGAAGGTCGTCGTATCTTTGTTACTGAAGTCGTTTGTGACAGTGTTCAATTCCTTGAACCTAAGAA
TTCACAAAATGGCGGTGGCCAACGTTCACAAAACAATGAATTCCAAGACTATGGTCAAGGATTCGGTGGTCAACAATCAG
GACAAAATACTTCGTATAACAACAATTCATCAAAACCTAATTCAAATCAATCAGATAATCCATTTGCGAATGCGAACGGA
CCTATTGATATTAGTGATGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

3D structure

• AlphaFold DB: A0A2V3ZFL8

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	61.453	100	0.643
ssb	Latilactobacillus sakei subsp. sakei 23K	52.601	100	0.532
ssb	Glaesserella parasuis strain SC1401	36.313	100	0.38
ssbB	Bacillus subtilis subsp. subtilis str. 168	60.377	61.988	0.374