Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   PYH52_RS07575 Genome accession   NZ_CP118794
Coordinates   1571797..1572666 (-) Length   289 a.a.
NCBI ID   WP_031463954.1    Uniprot ID   A0A8B2ZHG9
Organism   Staphylococcus warneri strain 7067     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1525346..1599295 1571797..1572666 within 0


Gene organization within MGE regions


Location: 1525346..1599295
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PYH52_RS07385 (PYH52_07380) - 1525827..1526042 (+) 216 WP_002467042.1 hypothetical protein -
  PYH52_RS07390 (PYH52_07385) rny 1526164..1527723 (-) 1560 WP_015365062.1 ribonuclease Y -
  PYH52_RS07395 (PYH52_07390) recA 1528170..1529216 (-) 1047 WP_002451246.1 recombinase RecA Machinery gene
  PYH52_RS07400 (PYH52_07395) - 1529383..1530534 (-) 1152 WP_002465812.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  PYH52_RS07405 (PYH52_07400) pgsA 1530707..1531282 (-) 576 WP_002465809.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  PYH52_RS07410 (PYH52_07405) - 1531313..1531705 (-) 393 WP_002465806.1 helix-turn-helix domain-containing protein -
  PYH52_RS07415 (PYH52_07410) - 1531726..1532562 (-) 837 WP_015365064.1 YmfK family protein -
  PYH52_RS07420 (PYH52_07415) - 1532697..1533401 (-) 705 WP_002465810.1 SDR family oxidoreductase -
  PYH52_RS07425 (PYH52_07420) - 1533398..1534687 (-) 1290 WP_015365066.1 pitrilysin family protein -
  PYH52_RS07430 (PYH52_07425) - 1534687..1535958 (-) 1272 WP_002465808.1 pitrilysin family protein -
  PYH52_RS07435 (PYH52_07430) - 1535986..1536699 (-) 714 WP_015365067.1 GntR family transcriptional regulator -
  PYH52_RS07440 (PYH52_07435) - 1536702..1539098 (-) 2397 WP_002466061.1 DNA translocase FtsK -
  PYH52_RS07445 (PYH52_07440) - 1539338..1541011 (-) 1674 WP_015365069.1 ribonuclease J -
  PYH52_RS07450 (PYH52_07445) pnp 1541198..1543297 (-) 2100 WP_002466036.1 polyribonucleotide nucleotidyltransferase -
  PYH52_RS07455 (PYH52_07450) rpsO 1543433..1543702 (-) 270 WP_002450539.1 30S ribosomal protein S15 -
  PYH52_RS07460 (PYH52_07455) ribF 1543816..1544787 (-) 972 WP_002466033.1 riboflavin biosynthesis protein RibF -
  PYH52_RS07465 (PYH52_07460) truB 1544800..1545717 (-) 918 WP_002466042.1 tRNA pseudouridine(55) synthase TruB -
  PYH52_RS07470 (PYH52_07465) rbfA 1545870..1546220 (-) 351 WP_002466047.1 30S ribosome-binding factor RbfA -
  PYH52_RS07475 (PYH52_07470) infB 1546360..1548525 (-) 2166 WP_015365072.1 translation initiation factor IF-2 -
  PYH52_RS07480 (PYH52_07475) - 1548530..1548847 (-) 318 WP_002466040.1 ribosomal L7Ae/L30e/S12e/Gadd45 family protein -
  PYH52_RS07485 (PYH52_07480) - 1548844..1549131 (-) 288 WP_002450545.1 YlxR family protein -
  PYH52_RS07490 (PYH52_07485) nusA 1549151..1550383 (-) 1233 WP_015365073.1 transcription termination factor NusA -
  PYH52_RS07495 (PYH52_07490) rimP 1550404..1550871 (-) 468 WP_002466062.1 ribosome maturation factor RimP -
  PYH52_RS07500 (PYH52_07495) - 1551054..1555364 (-) 4311 WP_107543659.1 PolC-type DNA polymerase III -
  PYH52_RS07505 (PYH52_07500) - 1555632..1557335 (-) 1704 WP_002466052.1 proline--tRNA ligase -
  PYH52_RS07510 (PYH52_07505) rseP 1557355..1558641 (-) 1287 WP_002466035.1 RIP metalloprotease RseP -
  PYH52_RS07515 (PYH52_07510) - 1558884..1559666 (-) 783 WP_002466065.1 phosphatidate cytidylyltransferase -
  PYH52_RS07520 (PYH52_07515) - 1559670..1560440 (-) 771 WP_002466060.1 isoprenyl transferase -
  PYH52_RS07525 (PYH52_07520) frr 1560673..1561227 (-) 555 WP_002450553.1 ribosome recycling factor -
  PYH52_RS07530 (PYH52_07525) pyrH 1561243..1561965 (-) 723 WP_002450554.1 UMP kinase -
  PYH52_RS07535 (PYH52_07530) tsf 1562106..1562984 (-) 879 WP_002466038.1 translation elongation factor Ts -
  PYH52_RS07540 (PYH52_07535) rpsB 1563136..1563924 (-) 789 WP_002466032.1 30S ribosomal protein S2 -
  PYH52_RS07545 (PYH52_07540) codY 1564231..1565004 (-) 774 WP_002450557.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  PYH52_RS07550 (PYH52_07545) hslU 1565028..1566431 (-) 1404 WP_353418766.1 ATP-dependent protease ATPase subunit HslU -
  PYH52_RS07555 (PYH52_07550) hslV 1566520..1567065 (-) 546 WP_002450559.1 ATP-dependent protease subunit HslV -
  PYH52_RS07560 (PYH52_07555) xerC 1567062..1567955 (-) 894 WP_353418767.1 tyrosine recombinase XerC -
  PYH52_RS07565 (PYH52_07560) trmFO 1568120..1569427 (-) 1308 WP_002466058.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  PYH52_RS07570 (PYH52_07565) topA 1569544..1571619 (-) 2076 WP_026088907.1 type I DNA topoisomerase -
  PYH52_RS07575 (PYH52_07570) dprA 1571797..1572666 (-) 870 WP_031463954.1 DNA-processing protein DprA Machinery gene
  PYH52_RS07580 (PYH52_07575) sucD 1572907..1573812 (-) 906 WP_002466045.1 succinate--CoA ligase subunit alpha -
  PYH52_RS07585 (PYH52_07580) sucC 1573834..1575000 (-) 1167 WP_002466034.1 ADP-forming succinate--CoA ligase subunit beta -
  PYH52_RS07590 (PYH52_07585) - 1575108..1575878 (-) 771 WP_002466053.1 ribonuclease HII -
  PYH52_RS07595 (PYH52_07590) ylqF 1575871..1576746 (-) 876 WP_002466050.1 ribosome biogenesis GTPase YlqF -
  PYH52_RS07600 (PYH52_07595) - 1577046..1579646 (+) 2601 WP_002466048.1 YfhO family protein -
  PYH52_RS07605 (PYH52_07600) - 1579639..1582248 (+) 2610 WP_002466046.1 YfhO family protein -
  PYH52_RS07610 (PYH52_07605) rplS 1582414..1582764 (-) 351 WP_002466049.1 50S ribosomal protein L19 -
  PYH52_RS07615 (PYH52_07610) trmD 1582870..1583607 (-) 738 WP_002466037.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  PYH52_RS07620 (PYH52_07615) rimM 1583607..1584110 (-) 504 WP_002466057.1 ribosome maturation factor RimM -
  PYH52_RS07625 (PYH52_07620) rpsP 1584278..1584553 (-) 276 WP_002466054.1 30S ribosomal protein S16 -
  PYH52_RS07630 (PYH52_07625) ffh 1585085..1586452 (-) 1368 WP_002450574.1 signal recognition particle protein -
  PYH52_RS07635 (PYH52_07630) - 1586477..1586809 (-) 333 WP_002466066.1 putative DNA-binding protein -
  PYH52_RS07640 (PYH52_07635) ftsY 1586796..1588040 (-) 1245 WP_002466030.1 signal recognition particle-docking protein FtsY -
  PYH52_RS07645 (PYH52_07640) smc 1588037..1591606 (-) 3570 WP_015365084.1 chromosome segregation protein SMC -
  PYH52_RS07650 (PYH52_07645) rnc 1591759..1592487 (-) 729 WP_015365085.1 ribonuclease III -
  PYH52_RS07655 (PYH52_07650) - 1592598..1592831 (-) 234 WP_001830184.1 acyl carrier protein -
  PYH52_RS07660 (PYH52_07655) fabG 1593044..1593778 (-) 735 WP_015365086.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  PYH52_RS07665 (PYH52_07660) fabD 1593778..1594698 (-) 921 WP_002466912.1 ACP S-malonyltransferase -
  PYH52_RS07670 (PYH52_07665) plsX 1594691..1595677 (-) 987 WP_353418771.1 phosphate acyltransferase PlsX -
  PYH52_RS07675 (PYH52_07670) fapR 1595670..1596239 (-) 570 WP_002466907.1 transcription factor FapR -
  PYH52_RS07680 (PYH52_07675) recG 1596389..1598437 (-) 2049 WP_002466919.1 ATP-dependent DNA helicase RecG -

Sequence

Protein


Download         Length: 289 a.a.        Molecular weight: 33695.74 Da        Isoelectric Point: 8.6890

>NTDB_id=795330 PYH52_RS07575 WP_031463954.1 1571797..1572666(-) (dprA) [Staphylococcus warneri strain 7067]
MNENFLPKLYWSHFTTSQIHQFYRYNPHIFQMTSNEQEISLLYWITQHHPTLLSKFHKYKQINIVEIMKILRQLHVKYIT
FFDEDYPYLLKEIYDYPFVLFYKGDKKLFLSNQTLAIVGARKCSNYTQEALQYLFPSFKEKNITIISGLAEGADSEAHIQ
ALKIDLSTIAVLGFGHHYYYPRNLVSLRKNIEEKGLVISEYPPFSPIAKYKFPERNRIISGLSKGVLLTESNERSGSRIT
VDCALEQNRNVYVLPGKLFDSKTKGNLLLHQEGASMVVSAEDILQDYLN

Nucleotide


Download         Length: 870 bp        

>NTDB_id=795330 PYH52_RS07575 WP_031463954.1 1571797..1572666(-) (dprA) [Staphylococcus warneri strain 7067]
TTGAACGAAAACTTTTTACCTAAATTATACTGGTCACATTTTACAACCTCACAAATCCATCAATTTTATCGGTACAACCC
TCATATTTTCCAAATGACTTCTAATGAACAAGAAATTTCATTATTATATTGGATTACTCAACATCATCCTACGCTTTTAT
CAAAATTTCATAAATATAAACAAATAAATATAGTAGAAATTATGAAAATTCTTCGACAATTACATGTAAAATATATCACT
TTTTTCGACGAAGATTATCCTTATTTATTAAAAGAAATCTATGATTATCCATTTGTTCTATTTTATAAGGGAGATAAGAA
ATTATTTTTAAGTAATCAAACTTTGGCAATTGTTGGTGCTAGGAAATGTTCAAATTATACGCAAGAAGCACTACAATATC
TTTTTCCTTCATTTAAAGAAAAAAATATTACGATTATTTCTGGGTTAGCAGAAGGTGCCGATAGTGAAGCACACATACAA
GCCTTGAAAATCGATTTATCAACCATTGCAGTATTAGGGTTTGGTCACCATTATTATTATCCTAGAAACTTAGTTTCATT
AAGAAAAAATATTGAAGAAAAGGGGTTAGTTATTTCGGAGTACCCACCATTTTCGCCAATTGCTAAGTATAAGTTTCCAG
AAAGAAATAGGATTATTAGTGGATTATCAAAAGGTGTATTATTAACTGAATCAAATGAAAGAAGTGGTAGCAGAATCACA
GTTGATTGTGCATTAGAACAAAATAGAAATGTGTATGTTTTACCGGGTAAATTATTTGATTCAAAAACAAAAGGAAATCT
ATTATTGCATCAAGAAGGAGCTTCTATGGTCGTTAGTGCTGAAGACATTTTACAAGACTATTTAAATTGA

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-278)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A8B2ZHG9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

55.634

98.27

0.547
  dprA Staphylococcus aureus MW2

55.634

98.27

0.547