Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   PWA59_RS13235 Genome accession   NZ_CP118541
Coordinates   2663533..2663847 (-) Length   104 a.a.
NCBI ID   WP_032863566.1    Uniprot ID   -
Organism   Bacillus velezensis strain HC-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2658533..2668847
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PWA59_RS13190 (PWA59_13190) sinI 2659214..2659387 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  PWA59_RS13195 (PWA59_13195) sinR 2659421..2659756 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PWA59_RS13200 (PWA59_13200) - 2659804..2660589 (-) 786 WP_007408329.1 TasA family protein -
  PWA59_RS13205 (PWA59_13205) - 2660654..2661238 (-) 585 WP_014418370.1 signal peptidase I -
  PWA59_RS13210 (PWA59_13210) tapA 2661210..2661881 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PWA59_RS13215 (PWA59_13215) - 2662140..2662469 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  PWA59_RS13220 (PWA59_13220) - 2662510..2662689 (-) 180 WP_003153093.1 YqzE family protein -
  PWA59_RS13225 (PWA59_13225) comGG 2662746..2663123 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  PWA59_RS13230 (PWA59_13230) comGF 2663124..2663519 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  PWA59_RS13235 (PWA59_13235) comGE 2663533..2663847 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  PWA59_RS13240 (PWA59_13240) comGD 2663831..2664268 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  PWA59_RS13245 (PWA59_13245) comGC 2664258..2664566 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  PWA59_RS13250 (PWA59_13250) comGB 2664571..2665608 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  PWA59_RS13255 (PWA59_13255) comGA 2665595..2666665 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  PWA59_RS13260 (PWA59_13260) - 2666858..2667808 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11920.92 Da        Isoelectric Point: 5.8321

>NTDB_id=793110 PWA59_RS13235 WP_032863566.1 2663533..2663847(-) (comGE) [Bacillus velezensis strain HC-5]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPDVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=793110 PWA59_RS13235 WP_032863566.1 2663533..2663847(-) (comGE) [Bacillus velezensis strain HC-5]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGATGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49