Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | PWA59_RS13190 | Genome accession | NZ_CP118541 |
| Coordinates | 2659214..2659387 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain HC-5 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2654214..2664387
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA59_RS13175 (PWA59_13175) | gcvT | 2655027..2656127 (-) | 1101 | WP_014418366.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PWA59_RS13180 (PWA59_13180) | - | 2656551..2658221 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| PWA59_RS13185 (PWA59_13185) | - | 2658243..2659037 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| PWA59_RS13190 (PWA59_13190) | sinI | 2659214..2659387 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| PWA59_RS13195 (PWA59_13195) | sinR | 2659421..2659756 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| PWA59_RS13200 (PWA59_13200) | - | 2659804..2660589 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| PWA59_RS13205 (PWA59_13205) | - | 2660654..2661238 (-) | 585 | WP_014418370.1 | signal peptidase I | - |
| PWA59_RS13210 (PWA59_13210) | tapA | 2661210..2661881 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| PWA59_RS13215 (PWA59_13215) | - | 2662140..2662469 (+) | 330 | WP_014418372.1 | DUF3889 domain-containing protein | - |
| PWA59_RS13220 (PWA59_13220) | - | 2662510..2662689 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| PWA59_RS13225 (PWA59_13225) | comGG | 2662746..2663123 (-) | 378 | WP_014418373.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| PWA59_RS13230 (PWA59_13230) | comGF | 2663124..2663519 (-) | 396 | WP_014721501.1 | competence type IV pilus minor pilin ComGF | - |
| PWA59_RS13235 (PWA59_13235) | comGE | 2663533..2663847 (-) | 315 | WP_032863566.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| PWA59_RS13240 (PWA59_13240) | comGD | 2663831..2664268 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=793107 PWA59_RS13190 WP_014418369.1 2659214..2659387(+) (sinI) [Bacillus velezensis strain HC-5]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=793107 PWA59_RS13190 WP_014418369.1 2659214..2659387(+) (sinI) [Bacillus velezensis strain HC-5]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |