Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PWA59_RS13190 Genome accession   NZ_CP118541
Coordinates   2659214..2659387 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain HC-5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2654214..2664387
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PWA59_RS13175 (PWA59_13175) gcvT 2655027..2656127 (-) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -
  PWA59_RS13180 (PWA59_13180) - 2656551..2658221 (+) 1671 WP_021494309.1 SNF2-related protein -
  PWA59_RS13185 (PWA59_13185) - 2658243..2659037 (+) 795 WP_014418368.1 YqhG family protein -
  PWA59_RS13190 (PWA59_13190) sinI 2659214..2659387 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  PWA59_RS13195 (PWA59_13195) sinR 2659421..2659756 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PWA59_RS13200 (PWA59_13200) - 2659804..2660589 (-) 786 WP_007408329.1 TasA family protein -
  PWA59_RS13205 (PWA59_13205) - 2660654..2661238 (-) 585 WP_014418370.1 signal peptidase I -
  PWA59_RS13210 (PWA59_13210) tapA 2661210..2661881 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PWA59_RS13215 (PWA59_13215) - 2662140..2662469 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  PWA59_RS13220 (PWA59_13220) - 2662510..2662689 (-) 180 WP_003153093.1 YqzE family protein -
  PWA59_RS13225 (PWA59_13225) comGG 2662746..2663123 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  PWA59_RS13230 (PWA59_13230) comGF 2663124..2663519 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  PWA59_RS13235 (PWA59_13235) comGE 2663533..2663847 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  PWA59_RS13240 (PWA59_13240) comGD 2663831..2664268 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=793107 PWA59_RS13190 WP_014418369.1 2659214..2659387(+) (sinI) [Bacillus velezensis strain HC-5]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=793107 PWA59_RS13190 WP_014418369.1 2659214..2659387(+) (sinI) [Bacillus velezensis strain HC-5]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719