Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PVT72_RS11520 Genome accession   NZ_CP118495
Coordinates   2461085..2461258 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain FC02     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2456085..2466258
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PVT72_RS11505 (PVT72_11505) gcvT 2456903..2458003 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  PVT72_RS11510 (PVT72_11510) - 2458426..2460096 (+) 1671 WP_003153107.1 SNF2-related protein -
  PVT72_RS11515 (PVT72_11515) - 2460114..2460908 (+) 795 WP_264254871.1 YqhG family protein -
  PVT72_RS11520 (PVT72_11520) sinI 2461085..2461258 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  PVT72_RS11525 (PVT72_11525) sinR 2461292..2461627 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PVT72_RS11530 (PVT72_11530) - 2461675..2462460 (-) 786 WP_003153102.1 TasA family protein -
  PVT72_RS11535 (PVT72_11535) - 2462524..2463108 (-) 585 WP_012117977.1 signal peptidase I -
  PVT72_RS11540 (PVT72_11540) tapA 2463080..2463751 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  PVT72_RS11545 (PVT72_11545) - 2464010..2464339 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PVT72_RS11550 (PVT72_11550) - 2464379..2464558 (-) 180 WP_003153093.1 YqzE family protein -
  PVT72_RS11555 (PVT72_11555) comGG 2464615..2464993 (-) 379 Protein_2229 competence type IV pilus minor pilin ComGG -
  PVT72_RS11560 (PVT72_11560) comGF 2464994..2465494 (-) 501 WP_274799405.1 competence type IV pilus minor pilin ComGF -
  PVT72_RS11565 (PVT72_11565) comGE 2465403..2465717 (-) 315 WP_274799406.1 competence type IV pilus minor pilin ComGE Machinery gene
  PVT72_RS11570 (PVT72_11570) comGD 2465701..2466138 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=792791 PVT72_RS11520 WP_003153105.1 2461085..2461258(+) (sinI) [Bacillus velezensis strain FC02]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=792791 PVT72_RS11520 WP_003153105.1 2461085..2461258(+) (sinI) [Bacillus velezensis strain FC02]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702