Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   PVT72_RS11565 Genome accession   NZ_CP118495
Coordinates   2465403..2465717 (-) Length   104 a.a.
NCBI ID   WP_274799406.1    Uniprot ID   -
Organism   Bacillus velezensis strain FC02     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2460403..2470717
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PVT72_RS11520 (PVT72_11520) sinI 2461085..2461258 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  PVT72_RS11525 (PVT72_11525) sinR 2461292..2461627 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PVT72_RS11530 (PVT72_11530) - 2461675..2462460 (-) 786 WP_003153102.1 TasA family protein -
  PVT72_RS11535 (PVT72_11535) - 2462524..2463108 (-) 585 WP_012117977.1 signal peptidase I -
  PVT72_RS11540 (PVT72_11540) tapA 2463080..2463751 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  PVT72_RS11545 (PVT72_11545) - 2464010..2464339 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PVT72_RS11550 (PVT72_11550) - 2464379..2464558 (-) 180 WP_003153093.1 YqzE family protein -
  PVT72_RS11555 (PVT72_11555) comGG 2464615..2464993 (-) 379 Protein_2229 competence type IV pilus minor pilin ComGG -
  PVT72_RS11560 (PVT72_11560) comGF 2464994..2465494 (-) 501 WP_274799405.1 competence type IV pilus minor pilin ComGF -
  PVT72_RS11565 (PVT72_11565) comGE 2465403..2465717 (-) 315 WP_274799406.1 competence type IV pilus minor pilin ComGE Machinery gene
  PVT72_RS11570 (PVT72_11570) comGD 2465701..2466138 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  PVT72_RS11575 (PVT72_11575) comGC 2466128..2466436 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  PVT72_RS11580 (PVT72_11580) comGB 2466441..2467478 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  PVT72_RS11585 (PVT72_11585) comGA 2467465..2468535 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  PVT72_RS11590 (PVT72_11590) - 2468727..2469677 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11843.86 Da        Isoelectric Point: 7.8118

>NTDB_id=792793 PVT72_RS11565 WP_274799406.1 2465403..2465717(-) (comGE) [Bacillus velezensis strain FC02]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTNWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=792793 PVT72_RS11565 WP_274799406.1 2465403..2465717(-) (comGE) [Bacillus velezensis strain FC02]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAAACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481