Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PUW21_RS17345 Genome accession   NZ_CP118167
Coordinates   3289577..3289717 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 21855     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3284577..3294717
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUW21_RS17320 (PUW21_17320) yuxO 3284890..3285270 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  PUW21_RS17325 (PUW21_17325) comA 3285289..3285933 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PUW21_RS17330 (PUW21_17330) comP 3286014..3288323 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  PUW21_RS17335 (PUW21_17335) comX 3288338..3288505 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  PUW21_RS17340 (PUW21_17340) comQ 3288493..3289392 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  PUW21_RS17345 (PUW21_17345) degQ 3289577..3289717 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PUW21_RS17350 (PUW21_17350) - 3289939..3290064 (+) 126 WP_003228793.1 hypothetical protein -
  PUW21_RS17355 (PUW21_17355) - 3290178..3290546 (+) 369 WP_003243784.1 hypothetical protein -
  PUW21_RS17360 (PUW21_17360) pdeH 3290522..3291751 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  PUW21_RS17365 (PUW21_17365) pncB 3291888..3293360 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  PUW21_RS17370 (PUW21_17370) pncA 3293376..3293927 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  PUW21_RS17375 (PUW21_17375) yueI 3294024..3294422 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=791000 PUW21_RS17345 WP_003220708.1 3289577..3289717(-) (degQ) [Bacillus subtilis strain 21855]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=791000 PUW21_RS17345 WP_003220708.1 3289577..3289717(-) (degQ) [Bacillus subtilis strain 21855]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1