Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   PUW21_RS17335 Genome accession   NZ_CP118167
Coordinates   3288338..3288505 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain 21855     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3283338..3293505
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUW21_RS17305 (PUW21_17305) mrpE 3283733..3284209 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  PUW21_RS17310 (PUW21_17310) mrpF 3284209..3284493 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  PUW21_RS17315 (PUW21_17315) mnhG 3284477..3284851 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  PUW21_RS17320 (PUW21_17320) yuxO 3284890..3285270 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  PUW21_RS17325 (PUW21_17325) comA 3285289..3285933 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PUW21_RS17330 (PUW21_17330) comP 3286014..3288323 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  PUW21_RS17335 (PUW21_17335) comX 3288338..3288505 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  PUW21_RS17340 (PUW21_17340) comQ 3288493..3289392 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  PUW21_RS17345 (PUW21_17345) degQ 3289577..3289717 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PUW21_RS17350 (PUW21_17350) - 3289939..3290064 (+) 126 WP_003228793.1 hypothetical protein -
  PUW21_RS17355 (PUW21_17355) - 3290178..3290546 (+) 369 WP_003243784.1 hypothetical protein -
  PUW21_RS17360 (PUW21_17360) pdeH 3290522..3291751 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  PUW21_RS17365 (PUW21_17365) pncB 3291888..3293360 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=790998 PUW21_RS17335 WP_003242801.1 3288338..3288505(-) (comX) [Bacillus subtilis strain 21855]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=790998 PUW21_RS17335 WP_003242801.1 3288338..3288505(-) (comX) [Bacillus subtilis strain 21855]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1