Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   PUW21_RS13390 Genome accession   NZ_CP118167
Coordinates   2568191..2568574 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain 21855     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2563191..2573574
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUW21_RS13350 (PUW21_13350) sinI 2564125..2564298 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  PUW21_RS13355 (PUW21_13355) sinR 2564332..2564667 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PUW21_RS13360 (PUW21_13360) tasA 2564760..2565545 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  PUW21_RS13365 (PUW21_13365) sipW 2565609..2566181 (-) 573 WP_003230181.1 signal peptidase I -
  PUW21_RS13370 (PUW21_13370) tapA 2566165..2566926 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  PUW21_RS13375 (PUW21_13375) yqzG 2567198..2567524 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PUW21_RS13380 (PUW21_13380) spoIIT 2567566..2567745 (-) 180 WP_003230176.1 YqzE family protein -
  PUW21_RS13385 (PUW21_13385) comGG 2567816..2568190 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  PUW21_RS13390 (PUW21_13390) comGF 2568191..2568574 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  PUW21_RS13395 (PUW21_13395) comGE 2568600..2568947 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  PUW21_RS13400 (PUW21_13400) comGD 2568931..2569362 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  PUW21_RS13405 (PUW21_13405) comGC 2569352..2569648 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  PUW21_RS13410 (PUW21_13410) comGB 2569662..2570699 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  PUW21_RS13415 (PUW21_13415) comGA 2570686..2571756 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  PUW21_RS13420 (PUW21_13420) corA 2572168..2573121 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=790977 PUW21_RS13390 WP_003230168.1 2568191..2568574(-) (comGF) [Bacillus subtilis strain 21855]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=790977 PUW21_RS13390 WP_003230168.1 2568191..2568574(-) (comGF) [Bacillus subtilis strain 21855]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1