Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   PUW21_RS13350 Genome accession   NZ_CP118167
Coordinates   2564125..2564298 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain 21855     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2559125..2569298
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUW21_RS13335 (PUW21_13335) gcvT 2559924..2561012 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  PUW21_RS13340 (PUW21_13340) yqhH 2561454..2563127 (+) 1674 WP_003230203.1 SNF2-related protein -
  PUW21_RS13345 (PUW21_13345) yqhG 2563148..2563942 (+) 795 WP_003230200.1 YqhG family protein -
  PUW21_RS13350 (PUW21_13350) sinI 2564125..2564298 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  PUW21_RS13355 (PUW21_13355) sinR 2564332..2564667 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PUW21_RS13360 (PUW21_13360) tasA 2564760..2565545 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  PUW21_RS13365 (PUW21_13365) sipW 2565609..2566181 (-) 573 WP_003230181.1 signal peptidase I -
  PUW21_RS13370 (PUW21_13370) tapA 2566165..2566926 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  PUW21_RS13375 (PUW21_13375) yqzG 2567198..2567524 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PUW21_RS13380 (PUW21_13380) spoIIT 2567566..2567745 (-) 180 WP_003230176.1 YqzE family protein -
  PUW21_RS13385 (PUW21_13385) comGG 2567816..2568190 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  PUW21_RS13390 (PUW21_13390) comGF 2568191..2568574 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  PUW21_RS13395 (PUW21_13395) comGE 2568600..2568947 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=790974 PUW21_RS13350 WP_003230187.1 2564125..2564298(+) (sinI) [Bacillus subtilis strain 21855]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=790974 PUW21_RS13350 WP_003230187.1 2564125..2564298(+) (sinI) [Bacillus subtilis strain 21855]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1