Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PT671_RS14755 Genome accession   NZ_CP118021
Coordinates   2982542..2982682 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii strain B-354     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2977542..2987682
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PT671_RS14725 - 2977837..2978235 (+) 399 WP_003220689.1 YueI family protein -
  PT671_RS14730 - 2978332..2978883 (+) 552 WP_003220692.1 cysteine hydrolase family protein -
  PT671_RS14735 - 2978899..2980371 (+) 1473 WP_003220693.1 nicotinate phosphoribosyltransferase -
  PT671_RS14740 pdeH 2980506..2981735 (+) 1230 WP_003220696.1 cyclic di-GMP phosphodiesterase -
  PT671_RS14745 - 2981711..2982079 (-) 369 WP_003220698.1 hypothetical protein -
  PT671_RS14750 - 2982194..2982310 (-) 117 WP_136975871.1 hypothetical protein -
  PT671_RS14755 degQ 2982542..2982682 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PT671_RS14760 - 2982868..2983728 (+) 861 WP_003220710.1 polyprenyl synthetase family protein -
  PT671_RS14765 comX 2983741..2983905 (+) 165 WP_003220712.1 competence pheromone ComX -
  PT671_RS14770 comP 2983913..2986237 (+) 2325 WP_003220714.1 histidine kinase Regulator
  PT671_RS14775 comA 2986318..2986962 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PT671_RS14780 - 2986978..2987358 (+) 381 WP_003220719.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=789168 PT671_RS14755 WP_003220708.1 2982542..2982682(+) (degQ) [Bacillus spizizenii strain B-354]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=789168 PT671_RS14755 WP_003220708.1 2982542..2982682(+) (degQ) [Bacillus spizizenii strain B-354]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1